Property Summary

NCBI Gene PubMed Count 289
Grant Count 244
R01 Count 181
Funding $28,794,435.58
PubMed Score 769.37
PubTator Score 511.75

Knowledge Summary

Patent (44,319)

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
osteosarcoma -2.285 0.002
glioblastoma 2.200 0.000
group 3 medulloblastoma 3.200 0.000
atypical teratoid / rhabdoid tumor 2.600 0.000
medulloblastoma, large-cell 3.100 0.000
primitive neuroectodermal tumor 3.000 0.000
Atopic dermatitis 1.700 0.000
adrenocortical carcinoma 1.048 0.020
non-small cell lung cancer 2.629 0.000
lung cancer 1.500 0.000
pediatric high grade glioma 1.800 0.000
posterior fossa group A ependymoma 1.300 0.000
psoriasis 1.600 0.000
Endometriosis 1.204 0.018
Breast cancer 1.200 0.000
invasive ductal carcinoma 1.500 0.000

Synonym

Accession Q96GD4 B4DNM4 C7G533 C7G534 C7G535 D3DTR4 J9JID1 O14630 O60446 O95083 Q96DV5 Q9UQ46
Symbols AIK2
AIM1
ARK2
AurB
IPL1
STK5
AIM-1
STK12
PPP1R48
aurkb-sv1
aurkb-sv2

Gene

PDB

4AF3  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (251)

PMID Text
27126587 Clk1, Clk2 and Clk4 prevent chromatin breakage by regulating the Aurora B-dependent abscission checkpoint.
27074040 NudC is co-localized with Aurora B at the midbody and co-immunoprecipitated with Aurora B in mitosis. results suggest that that dynamic phosphorylation of NudC by Aurora B regulates cytokinesis.
27030108 Aurora B and CDK1 temporally regulate the binding affinity of EB2 for microtubules, thereby ensuring kinetochore microtubule dynamics, proper mitotic progression and genome stability.
26954544 HP1 binding to the chromosomal passenger complex becomes particularly important when Aurora B phosphorylates kinetochore targets to eliminate erroneous microtubule attachments
26842935 Aurora kinases are important KRAS targets in lung cancer.
26777301 PC4 associates with Aurora A and Aurora B and undergoes phosphorylation, following which PC4 activates both Aurora A and B to sustain optimal kinase activity to maintain the phosphorylation gradient for the proper functioning of the mitotic machinery.
26766443 UBASH3B is necessary for the timing and fidelity of chromosome segregation in human cells
26660542 Combined treatment with aurora kinase inhibitor SNS-314and quercetin-hyaluronic acid hydrogel results in synergistic cytotoxic effects in papillary and medullary thyroid carcinoma cells.
26656854 Study reports that the monomeric RING domains from the human E3 ligases Arkadia and Ark2C bind directly to free ubiquitin with an affinity comparable to that of other dedicated ubiquitin-binding domains.
26560693 These results demonstrate that Aurora B inhibits both direct interaction with the microtubule and oligomerization of the Dam1 complex to drive error correction during mitosis.
More...

AA Sequence

MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTR      1 - 70
HFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEHQLRREIEIQAHLHHPNILRL     71 - 140
YNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIMEELADALMYCHGKKVIHRDIKPENLLLGL    141 - 210
KGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNE    211 - 280
TYRRIVKVDLKFPASVPMGAQDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA          281 - 344
//

Text Mined References (304)

PMID Year Title
27126587 2016 Clks 1, 2 and 4 prevent chromatin breakage by regulating the Aurora B-dependent abscission checkpoint.
27074040 2016 Dynamic Phosphorylation of NudC by Aurora B in Cytokinesis.
27030108 2016 Phosphorylation of EB2 by Aurora B and CDK1 ensures mitotic progression and genome stability.
26954544 2016 HP1-Assisted Aurora B Kinase Activity Prevents Chromosome Segregation Errors.
26842935 2016 Aurora kinase targeting in lung cancer reduces KRAS-induced transformation.
26777301 2016 Multifunctional human transcriptional coactivator protein PC4 is a substrate of Aurora kinases and activates the Aurora enzymes.
26766443 2016 Ubiquitin Receptor Protein UBASH3B Drives Aurora B Recruitment to Mitotic Microtubules.
26660542 2016 New Treatment of Medullary and Papillary Human Thyroid Cancer: Biological Effects of Hyaluronic Acid Hydrogel Loaded With Quercetin Alone or in Combination to an Inhibitor of Aurora Kinase.
26656854 2016 Secondary ubiquitin-RING docking enhances Arkadia and Ark2C E3 ligase activity.
26560693 2015 The molecular architecture of the Dam1 kinetochore complex is defined by cross-linking based structural modelling.
More...