Property Summary

NCBI Gene PubMed Count 16
PubMed Score 235.69
PubTator Score 1660.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Laurence-Moon syndrome 6 4.0 2.0
Kidney disease 430 3.917 2.0

Expression

Gene RIF (7)

AA Sequence

MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGERAVPGAPELLERLARAGKAALFVSNNSRRARPELAL      1 - 70
RFARLGFGGLRAEQLFSSALCAARLLRQRLPGPPDAPGAVFVLGGEGLRAELRAAGLRLAGDPSAGDGAA     71 - 140
PRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALV    141 - 210
VGKPSPYMFECITENFSIDPARTLMVGDRLETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVP    211 - 280
HYYVESIADLTEGLED                                                          281 - 296
//

Text Mined References (18)

PMID Year Title