Property Summary

NCBI Gene PubMed Count 16
Grant Count 123
R01 Count 63
Funding $17,883,877.29
PubMed Score 224.29
PubTator Score 1660.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q96GD0 Q9UGY2 PLP phosphatase
Symbols CIN
PLP
dJ37E16.5

Gene

PANTHER Protein Class (2)

PDB

2CFR   2CFS   2CFT   2OYC   2P27   2P69  

Gene RIF (7)

PMID Text
26324884 Chronophin has a role in coordinating cell leading edge dynamics by controlling active cofilin levels
23223568 Splicing of SH3BP1 and CIN gene loci produces the novel brain specific splice variant BGIN.
19000834 Study demonstrates the ATP-sensitive interaction of the cofilin phosphatase chronophin (CIN) with the chaperone hsp90 to form a biosensor that mediates cofilin/actin rod formation.
18510874 Results suggest that the transduction of the PEP-1-PLPP fusion protein can be one mode of PLP level regulation, and to replenish this enzyme in the various neurological disorders related to vitamin B(6).
16336786 analysis of brain pyridoxal-5'-phosphate phosphatase
15580268 We report the biochemical isolation of chronophin (CIN), a unique cofilin-activating phosphatase of the haloacid dehalogenase (HAD) superfamily and an important novel regulator of cofilin-mediated actin reorganization.
14522954 analysis of pyridoxal phosphatase cloning, expression and tissue distribution

AA Sequence

MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGERAVPGAPELLERLARAGKAALFVSNNSRRARPELAL      1 - 70
RFARLGFGGLRAEQLFSSALCAARLLRQRLPGPPDAPGAVFVLGGEGLRAELRAAGLRLAGDPSAGDGAA     71 - 140
PRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALV    141 - 210
VGKPSPYMFECITENFSIDPARTLMVGDRLETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVP    211 - 280
HYYVESIADLTEGLED                                                          281 - 296
//

Text Mined References (18)

PMID Year Title
26324884 2015 Chronophin coordinates cell leading edge dynamics by controlling active cofilin levels.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23223568 2013 A novel Rac1 GAP splice variant relays poly-Ub accumulation signals to mediate Rac1 inactivation.
21897333 2011 Genes linked to energy metabolism and immunoregulatory mechanisms are associated with subcutaneous adipose tissue distribution in HIV-infected men.
21269460 2011 Initial characterization of the human central proteome.
19000834 2008 Chronophin mediates an ATP-sensing mechanism for cofilin dephosphorylation and neuronal cofilin-actin rod formation.
18510874 2008 Human brain pyridoxal-5'-phosphate phosphatase (PLPP):protein transduction of PEP-1-PLPP into PC12 cells.
18058037 2007 Structural genomics of protein phosphatases.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17500066 2007 Beta-arrestin-dependent regulation of the cofilin pathway downstream of protease-activated receptor-2.
More...