Property Summary

NCBI Gene PubMed Count 30
PubMed Score 302.11
PubTator Score 35.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.858 3.4e-06
dermatomyositis 1.500 2.2e-03
diabetes mellitus -1.200 1.1e-02
Duchenne muscular dystrophy 1.072 6.7e-06
ductal carcinoma in situ 1.200 1.1e-02
glioblastoma 2.500 1.2e-03
invasive ductal carcinoma 1.800 4.2e-04
juvenile dermatomyositis 1.438 1.1e-10
lung adenocarcinoma 1.281 7.9e-10
Multiple myeloma 1.578 2.3e-04
ovarian cancer -1.100 1.0e-02
pancreatic cancer 1.200 6.5e-03
primary pancreatic ductal adenocarcinoma 1.150 8.1e-03
psoriasis 1.800 7.5e-05

Gene RIF (20)

AA Sequence

MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLEILVILKEWTS      1 - 70
KLWHRQSIVVSFLLLLAVLIATYYVEGVHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGP     71 - 140
HIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPYFMAR    141 - 210
AARLSGAEPDDEEYQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGH    211 - 280
FLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLH    281 - 350
HKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK                  351 - 406
//

Text Mined References (34)

PMID Year Title