Property Summary

NCBI Gene PubMed Count 26
Grant Count 240
R01 Count 117
Funding $31,747,026.93
PubMed Score 245.37
PubTator Score 35.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.578 0.000
psoriasis 1.800 0.000
glioblastoma 2.500 0.001
Duchenne muscular dystrophy 1.072 0.000
juvenile dermatomyositis 1.438 0.000
acute quadriplegic myopathy 1.858 0.000
primary pancreatic ductal adenocarcinoma 1.150 0.008
diabetes mellitus -1.200 0.011
lung adenocarcinoma 1.281 0.000
ductal carcinoma in situ 1.200 0.011
invasive ductal carcinoma 1.800 0.000
ovarian cancer 4.100 0.000
pancreatic cancer 1.200 0.007
dermatomyositis 1.500 0.002

Synonym

Accession Q96GC9 B4DVV9 Q9H0P4 Q9P089
Symbols EPG3
TANGO5
TMEM49

Gene

PANTHER Protein Class (1)

Gene RIF (16)

PMID Text
26328607 Study indicated that the expression of VMP1 was down-regulated and negatively correlated to the prognosis of colorectal cancer.
24365149 In colorectal cancer cells, VMP1-dependent autophagy appears to be pro-survival rather than pro-cell death.
23710913 in patients with invasive ductal carcinoma of the breast, Vmp1 expression had significant influence on disease-free survival time, with Vmp1-negative patients showing poor prognosis
23460482 These results underscore a novel role for VMP1 as a potential therapeutic target for combinatorial therapies aimed at sensitizing pancreatic cancer cells to chemotherapeutic agents
23316280 The VMP1-Beclin 1 interaction regulates autophagy induction.
22971212 upregulation of Vmp1 was associated with suppression of growth and pulmonary metastases of HCC.
22535956 AKT1-GLI3-VMP1 pathway mediates KRAS oncogene-induced autophagy in cancer cells.
22404213 Knockdown of vacuole membrane protein 1 (VMP1) by siRNA inhibits HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
22333543 The expression of VMP1 had significant negative influence on the survival rate of non-small-cell lung cancer patients.
22144109 VMP1 is reduced by hypoxia, and down-regulation of VMP1 by miR-210 mediates hypoxia-induced HCC cell metastasis.
More...

AA Sequence

MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLEILVILKEWTS      1 - 70
KLWHRQSIVVSFLLLLAVLIATYYVEGVHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGP     71 - 140
HIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPYFMAR    141 - 210
AARLSGAEPDDEEYQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGH    211 - 280
FLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLH    281 - 350
HKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK                  351 - 406
//

Text Mined References (30)

PMID Year Title
26328607 2015 Downregulation of VMP1 confers aggressive properties to colorectal cancer.
24365149 2014 VMP1 related autophagy and apoptosis in colorectal cancer cells: VMP1 regulates cell death.
23710913 2013 [Expression of vacuole membrane protein 1 and its prognostic value in invasive ductal carcinoma of the breast].
23460482 2013 Novel role of VMP1 as modifier of the pancreatic tumor cell response to chemotherapeutic drugs.
23316280 2013 The VMP1-Beclin 1 interaction regulates autophagy induction.
23118302 2012 Genome-wide association study evaluating lipoprotein-associated phospholipase A2 mass and activity at baseline and after rosuvastatin therapy.
22971212 2012 Novel roles of Vmp1: inhibition metastasis and proliferation of hepatocellular carcinoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22535956 2012 Novel AKT1-GLI3-VMP1 pathway mediates KRAS oncogene-induced autophagy in cancer cells.
22333543 2011 [Expression and prognostic value of vacuole membrane protein 1 in non-small-cell lung cancer].
More...