Property Summary

NCBI Gene PubMed Count 15
PubMed Score 23.10
PubTator Score 15.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.100 2.5e-03
ependymoma 1.100 4.4e-03
intraductal papillary-mucinous adenoma (... 1.200 2.4e-03
lung cancer -2.300 6.9e-04
osteosarcoma -1.518 1.4e-04
ovarian cancer -1.500 4.5e-09
primary pancreatic ductal adenocarcinoma 1.042 1.1e-02
spina bifida -1.046 4.0e-02
tuberculosis -1.100 6.8e-05

Protein-protein Interaction (8)

Gene RIF (3)

AA Sequence

MASRLPTAWSCEPVTFEDVTLGFTPEEWGLLDLKQKSLYREVMLENYRNLVSVEHQLSKPDVVSQLEEAE      1 - 70
DFWPVERGIPQDTIPEYPELQLDPKLDPLPAESPLMNIEVVEVLTLNQEVAGPRNAQIQALYAEDGSLSA     71 - 140
DAPSEQVQQQGKHPGDPEAARQRFRQFRYKDMTGPREALDQLRELCHQWLQPKARSKEQILELLVLEQFL    141 - 210
GALPVKLRTWVESQHPENCQEVVALVEGVTWMSEEEVLPAGQPAEGTTCCLEVTAQQEEKQEDAAICPVT    211 - 280
VLPEEPVTFQDVAVDFSREEWGLLGPTQRTEYRDVMLETFGHLVSVGWETTLENKELAPNSDIPEEEPAP    281 - 350
SLKVQESSRDCALSSTLEDTLQGGVQEVQDTVLKQMESAQEKDLPQKKHFDNRESQANSGALDTNQVSLQ    351 - 420
KIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSR    421 - 490
STKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHTGERPYVCQDCGKGFVQSSSLTQHQRVHSGE    491 - 560
RPFECQECGRTFNDRSAISQHLRTHTGAKPYKCQDCGKAFRQSSHLIRHQRTHTGERPYACNKCGKAFTQ    561 - 630
SSHLIGHQRTHNRTKRKKKQPTS                                                   631 - 653
//

Text Mined References (17)

PMID Year Title