Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.06
PubTator Score 1.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 4.7e-05
ovarian cancer 8520 5.1e-04
osteosarcoma 7950 7.8e-04
Disease Target Count Z-score Confidence
adrenocortical carcinoma 1428 4.127 2.1

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 2.100 4.7e-05
osteosarcoma -1.091 7.8e-04
ovarian cancer 1.300 5.1e-04

Gene RIF (1)

AA Sequence

MSGTLEKVLCLRNNTIFKQAFSLLRFRTSGEKPIYSVGGILLSISRPYKTKPTHGIGKYKHLIKAEEPKK      1 - 70
KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIKVEESYAMPTKTIEVLQLQDQ     71 - 140
GSKMLLDSVLTTHERVVQISGLSATFAEIFLEIIQSSLPEGVRLSVKEHTEEDFKGRFKARPELEELLAK    141 - 210
LK                                                                        211 - 212
//

Text Mined References (20)

PMID Year Title