Property Summary

NCBI Gene PubMed Count 8
PubMed Score 638.59
PubTator Score 37.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma 1.400 4.7e-09
pancreatic ductal adenocarcinoma liver m... -2.232 1.3e-03
posterior fossa group B ependymoma 1.100 3.0e-06
tuberculosis -1.400 1.1e-04

Synonym

Accession Q96GA7
Symbols TDH
cSDH
SDH 2
SDS-RS1

Gene

PANTHER Protein Class (2)

PDB

2RKB  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIRGIGHFCQEMAKKGCRHLVCS      1 - 70
SGGNAGIAAAYAARKLGIPATIVLPESTSLQVVQRLQGEGAEVQLTGKVWDEANLRAQELAKRDGWENVP     71 - 140
PFDHPLIWKGHASLVQELKAVLRTPPGALVLAVGGGGLLAGVVAGLLEVGWQHVPIIAMETHGAHCFNAA    141 - 210
ITAGKLVTLPDITSVAKSLGAKTVAARALECMQVCKIHSEVVEDTEAVSAVQQLLDDERMLVEPACGAAL    211 - 280
AAIYSGLLRRLQAEGCLPPSLTSVVVIVCGGNNINSRELQALKTHLGQV                         281 - 329
//

Text Mined References (11)

PMID Year Title