Property Summary

NCBI Gene PubMed Count 29
PubMed Score 812.19
PubTator Score 56.62

Knowledge Summary

Patent (1,475)

Expression

Gene RIF (18)

PMID Text
26078273 Hypoxia/reoxygenation inhibits P2y11 receptor expression and its immunosuppressive activity in human dendritic cells.
24588705 Suggest role for LXA4 in stimulating apical ATP secretion via pannexin-1 channels and P2RY11 purinoreceptors activation leading to an airway surface liquid layer height increase and epithelial repair.
24524250 the physiological impact of A87T mutation of the P2Y11 receptor derives from detrimental effects on P2Y1-P2Y11 receptor interaction.
23577075 vesicular exocytosis of ATP and autocrine, positive feedback through P2Y11 receptors is required for the effective activation of macrophages
23461851 P2Y11 receptor mediates interferon gamma-induced IL-6 production in HaCaT cells, suggesting the importance of purinergic signaling in interferon-gamma induced skin inflammatory conditions
22177342 The study extends on the observation of a strong multiethnic association of polymorphisms in the TCRA and P2RY11 with narcolepsy, but does not confirm the association of CPT1B/CHKB (rs5770917) in the Chinese population.
22052557 P2Y11 receptors are abundantly and diffusely expressed intracellularly in skeletal muscle fibers.
21170044 Common variants in P2RY11 are associated with narcolepsy.
20964598 Extracellular NAD stimulates mesenchymal stem cell functions through activation of P2Y11 receptor.
20668227 Inhibition of Natural killer cell response to CX3CL1 is mediated by the P2Y11 receptor.
18726826 present data clearly show that P2Y purinoceptor 11 and P2Y purinoceptor 12 are expressed in human pancreatic islets
18056402 The P2 receptor mediating the antiapoptotic actions of ATP was identified using a combination of more selective ATP analogs, receptor expression studies, and study of downstream signaling pathways.
17824841 oligomerization of the P2Y11 receptor with the P2Y1 receptor controls the internalization and ligand selectivity of the P2Y11 receptor
17707504 In human granulocytes, endogenous P2Y(11) proved to be responsible for NAADP+-induced cell activation, unveiling a role of NAADP+ as a pro-inflammatory cytokine.
17338680 We propose that residues Arg106, Arg268, Arg307 and Glu186 are involved in ionic interactions with the phosphate moiety of ATP. Arg307 is possibly also H-bonded to N6 of ATP via the backbone carbonyl.
17135283 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16926152 beta-NAD(e)+ is an agonist of the P2Y(11) purinoceptor and P2Y(11) is the endogenous receptor in granulocytes mediating the sustained [Ca2+]i increase responsible for their functional activatio
11690642 expression profile in human peripheral tissues and brain regions using PCR

AA Sequence

MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRPWHPAVVFSVQ      1 - 70
LAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFITCISLNRYLGIVHPFFARSH     71 - 140
LRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNCSVARPEACIKCLGTADHGLAAYRAYSLVLA    141 - 210
GLGCGLPLLLTLAAYGALGRAVLRSPGMTVAEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWST    211 - 280
RCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKST    281 - 350
GQALPLNATAAPKPSEPQSRELSQ                                                  351 - 374
//

Text Mined References (30)

PMID Year Title
26078273 2015 Hypoxia/Reoxygenation Inhibits P2Y11 Receptor Expression and Its Immunosuppressive Activity in Human Dendritic Cells.
24588705 2014 Activation of P2RY11 and ATP release by lipoxin A4 restores the airway surface liquid layer and epithelial repair in cystic fibrosis.
24524250 2014 Alanine-(87)-threonine polymorphism impairs signaling and internalization of the human P2Y11 receptor, when co-expressed with the P2Y1 receptor.
24204295 2013 Genome wide analysis of narcolepsy in China implicates novel immune loci and reveals changes in association prior to versus after the 2009 H1N1 influenza pandemic.
23577075 2013 Autocrine regulation of macrophage activation via exocytosis of ATP and activation of P2Y11 receptor.
23461851 2013 Involvement of P2Y?? receptor in IFN-?-induced IL-6 production in human keratinocytes.
22177342 2012 TCRA, P2RY11, and CPT1B/CHKB associations in Chinese narcolepsy.
22052557 2012 Purinergic receptors expressed in human skeletal muscle fibres.
21170044 2011 Common variants in P2RY11 are associated with narcolepsy.
20964598 2011 Regulation of human mesenchymal stem cell functions by an autocrine loop involving NAD+ release and P2Y11-mediated signaling.
20668227 2010 ATP secreted by endothelial cells blocks CX?CL 1-elicited natural killer cell chemotaxis and cytotoxicity via P2Y?? receptor activation.
18726826 2008 Human pancreatic islets express the purinergic P2Y11 and P2Y12 receptors.
18056402 2007 Inhibition of neutrophil apoptosis by ATP is mediated by the P2Y11 receptor.
18048695 2008 Involvement of P2Y1 and P2Y11 purinoceptors in parasympathetic inhibition of colonic smooth muscle.
17824841 2008 Hetero-oligomerization of the P2Y11 receptor with the P2Y1 receptor controls the internalization and ligand selectivity of the P2Y11 receptor.
17707504 2008 NAADP+ is an agonist of the human P2Y11 purinergic receptor.
17338680 2007 Structure and ligand-binding site characteristics of the human P2Y11 nucleotide receptor deduced from computational modelling and mutational analysis.
17135283 2007 Increased risk of acute myocardial infarction and elevated levels of C-reactive protein in carriers of the Thr-87 variant of the ATP receptor P2Y11.
16926152 2006 Extracellular NAD+ is an agonist of the human P2Y11 purinergic receptor in human granulocytes.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077223 2002 Extracellular adenine nucleotides inhibit the activation of human CD4+ T lymphocytes.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11690642 2001 Expression pattern of human P2Y receptor subtypes: a quantitative reverse transcription-polymerase chain reaction study.
11278528 2001 Cotranscription and intergenic splicing of human P2Y11 and SSF1 genes.
10947861 2000 Signal transduction and white cell maturation via extracellular ATP and the P2Y11 receptor.
9405388 1997 Cloning of a human purinergic P2Y receptor coupled to phospholipase C and adenylyl cyclase.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.