Property Summary

NCBI Gene PubMed Count 29
Grant Count 22
R01 Count 9
Funding $1,377,208.49
PubMed Score 812.19
PubTator Score 56.62

Knowledge Summary

Patent (1,475)

Expression

Gene RIF (18)

PMID Text
26078273 Hypoxia/reoxygenation inhibits P2y11 receptor expression and its immunosuppressive activity in human dendritic cells.
24588705 Suggest role for LXA4 in stimulating apical ATP secretion via pannexin-1 channels and P2RY11 purinoreceptors activation leading to an airway surface liquid layer height increase and epithelial repair.
24524250 the physiological impact of A87T mutation of the P2Y11 receptor derives from detrimental effects on P2Y1-P2Y11 receptor interaction.
23577075 vesicular exocytosis of ATP and autocrine, positive feedback through P2Y11 receptors is required for the effective activation of macrophages
23461851 P2Y11 receptor mediates interferon gamma-induced IL-6 production in HaCaT cells, suggesting the importance of purinergic signaling in interferon-gamma induced skin inflammatory conditions
22177342 The study extends on the observation of a strong multiethnic association of polymorphisms in the TCRA and P2RY11 with narcolepsy, but does not confirm the association of CPT1B/CHKB (rs5770917) in the Chinese population.
22052557 P2Y11 receptors are abundantly and diffusely expressed intracellularly in skeletal muscle fibers.
21170044 Common variants in P2RY11 are associated with narcolepsy.
20964598 Extracellular NAD stimulates mesenchymal stem cell functions through activation of P2Y11 receptor.
20668227 Inhibition of Natural killer cell response to CX3CL1 is mediated by the P2Y11 receptor.
More...

AA Sequence

MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRPWHPAVVFSVQ      1 - 70
LAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFITCISLNRYLGIVHPFFARSH     71 - 140
LRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNCSVARPEACIKCLGTADHGLAAYRAYSLVLA    141 - 210
GLGCGLPLLLTLAAYGALGRAVLRSPGMTVAEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWST    211 - 280
RCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKST    281 - 350
GQALPLNATAAPKPSEPQSRELSQ                                                  351 - 374
//

Text Mined References (30)

PMID Year Title
26078273 2015 Hypoxia/Reoxygenation Inhibits P2Y11 Receptor Expression and Its Immunosuppressive Activity in Human Dendritic Cells.
24588705 2014 Activation of P2RY11 and ATP release by lipoxin A4 restores the airway surface liquid layer and epithelial repair in cystic fibrosis.
24524250 2014 Alanine-(87)-threonine polymorphism impairs signaling and internalization of the human P2Y11 receptor, when co-expressed with the P2Y1 receptor.
24204295 2013 Genome wide analysis of narcolepsy in China implicates novel immune loci and reveals changes in association prior to versus after the 2009 H1N1 influenza pandemic.
23577075 2013 Autocrine regulation of macrophage activation via exocytosis of ATP and activation of P2Y11 receptor.
23461851 2013 Involvement of P2Y?? receptor in IFN-?-induced IL-6 production in human keratinocytes.
22177342 2012 TCRA, P2RY11, and CPT1B/CHKB associations in Chinese narcolepsy.
22052557 2012 Purinergic receptors expressed in human skeletal muscle fibres.
21170044 2011 Common variants in P2RY11 are associated with narcolepsy.
20964598 2011 Regulation of human mesenchymal stem cell functions by an autocrine loop involving NAD+ release and P2Y11-mediated signaling.
More...