Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.85
PubTator Score 3.97

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSVEDGGMPGLGRPRQARWTLMLLLSTAMYGAHAPLLALCHVDGRVPFRPSSAVLLTELTKLLLCAFSLL      1 - 70
VGWQAWPQGPPPWRQAAPFALSALLYGANNNLVIYLQRYMDPSTYQVLSNLKIGSTAVLYCLCLRHRLSV     71 - 140
RQGLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLLILYCLISGLSSVYTELLM    141 - 210
KRQRLPLALQNLFLYTFGVLLNLGLHAGGGSGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRL    211 - 280
FVVSCSLVVNAVLSAVLLRLQLTAAFFLATLLIGLAMRLYYGSR                              281 - 324
//

Text Mined References (8)

PMID Year Title
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12782588 2003 Gene and peptide analyses of newly defined lung cancer antigens recognized by HLA-A2402-restricted tumor-specific cytotoxic T lymphocytes.
12770764 The nucleotide-sugar transporter family: a phylogenetic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.