Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 5.8e-12
ovarian cancer 8519 1.0e-07
malignant mesothelioma 3232 2.2e-06
psoriasis 6694 1.0e-05
lung cancer 4740 3.8e-03
esophageal adenocarcinoma 737 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma -1.200 2.0e-02
lung cancer 1.700 3.8e-03
malignant mesothelioma 1.600 2.2e-06
osteosarcoma -3.929 5.8e-12
ovarian cancer 1.100 1.0e-07
psoriasis -3.000 1.0e-05

Synonym

Accession Q96G75 Q1HE27 Q6UVY7 Q9H6F6
Symbols GID2
GID2B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MEQCACVERELDKVLQKFLTYGQHCERSLEELLHYVGQLRAELASAALQGTPLSATLSLVMSQCCRKIKD      1 - 70
TVQKLASDHKDIHSSVSRVGKAIDRNFDSEICGVVSDAVWDAREQQQQILQMAIVEHLYQQGMLSVAEEL     71 - 140
CQESTLNVDLDFKQPFLELNRILEALHEQDLGPALEWAVSHRQRLLELNSSLEFKLHRLHFIRLLAGGPA    141 - 210
KQLEALSYARHFQPFARLHQREIQVMMGSLVYLRLGLEKSPYCHLLDSSHWAEICETFTRDACSLLGLSV    211 - 280
ESPLSVSFASGCVALPVLMNIKAVIEQRQCTGVWNHKDELPIEIELGMKCWYHSVFACPILRQQTSDSNP    281 - 350
PIKLICGHVISRDALNKLINGGKLKCPYCPMEQNPADGKRIIF                               351 - 393
//

Text Mined References (11)

PMID Year Title