Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.75
PubTator Score 7.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.801 0.000

Synonym

Accession Q96G74 B4DGG7 G5E9D7 Q4KMN9 Q8N6T5 Q9H650 Q9H9U0 Q9NT65
Symbols DUBA

Gene

PANTHER Protein Class (2)

PDB

3TMP   3PFY   3TMO  

Gene RIF (4)

PMID Text
25499082 Findings have uncovered an apoptotic signaling cascade linking PDCD5, OTUD5, and p53 during genotoxic stress responses.
24143256 OTUD5 is required for the stabilization and the activation of a p53 response
22245969 Here the authors show that phosphorylation of the human deubiquitinase DUBA (OTUD5) at a single residue, Ser177, is both necessary and sufficient to activate the enzyme.
17991829 data identify DUBA as a negative regulator of innate immune responses

AA Sequence

MTILPKKKPPPPDADPANEPPPPGPMPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGARPRASPPPQGP      1 - 70
LPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAAAAGVGAAGVVVGVGGAVGVG     71 - 140
GCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDK    141 - 210
KGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHG    211 - 280
NHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGL    281 - 350
GLPSFKPGFAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQ    351 - 420
VRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALAKPPSP    421 - 490
CAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASVLAVSQQEYLDSMKKN    491 - 560
KVHRDPPPDKS                                                               561 - 571
//

Text Mined References (25)

PMID Year Title
25499082 2015 Deubiquitinase OTUD5 mediates the sequential activation of PDCD5 and p53 in response to genotoxic stress.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24143256 2013 OTUD5 regulates p53 stability by deubiquitinating p53.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22245969 2012 Phosphorylation-dependent activity of the deubiquitinase DUBA.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...