Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.94
PubTator Score 19.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia -2.000 1.0e-02
astrocytoma -1.900 4.8e-02
glioblastoma multiforme -1.100 2.2e-15
intraductal papillary-mucinous adenoma (... -1.700 1.0e-04
intraductal papillary-mucinous carcinoma... -1.800 1.9e-04
intraductal papillary-mucinous neoplasm ... -1.400 9.1e-03
malignant mesothelioma -3.600 2.0e-07
non-small cell lung cancer 1.311 2.3e-08
Pick disease -1.600 9.3e-03
psoriasis -1.100 2.6e-02

Synonym

Accession Q96G61 Q9NVN0 DIPP-3-beta
Symbols APS1
ASP1
DIPP3b
DIPP3beta
hDIPP3beta

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG

Gene RIF (6)

AA Sequence

MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEA      1 - 70
GVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYL     71 - 140
EKLKLGGSPTNGNSMAPSSPDSDP                                                  141 - 164
//

Text Mined References (18)

PMID Year Title