Property Summary

NCBI Gene PubMed Count 17
Grant Count 23
R01 Count 13
Funding $2,385,025.92
PubMed Score 4.77
PubTator Score 19.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
22730461 NUDT11, HNF1B, and SLC22A3 genes have roles in prostate cancer pathogenesis
21071540 Observational study of gene-disease association. (HuGE Navigator)
19902474 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of nudix (nucleoside diphosphate linked moiety X)-type motif 11 (NUDT11) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
12121577 Cloning and characterisation of NUDT11 as a diadenosine polyphosphate-metabolising Nudix hydrolase.
12105228 The NUDT11 gene, located on chromosome X, is preferentially expressed in the testis

AA Sequence

MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEA      1 - 70
GVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYL     71 - 140
EKLKLGGSPTNGNSMAPSSPDSDP                                                  141 - 164
//

Text Mined References (18)

PMID Year Title
22730461 2012 Genetic and functional analyses implicate the NUDT11, HNF1B, and SLC22A3 genes in prostate cancer pathogenesis.
21269460 2011 Initial characterization of the human central proteome.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
19902474 2010 Replication of prostate cancer risk loci on 8q24, 11q13, 17q12, 19q33, and Xp11 in African Americans.
18264098 2008 Common sequence variants on 2p15 and Xp11.22 confer susceptibility to prostate cancer.
18264097 2008 Multiple newly identified loci associated with prostate cancer susceptibility.
16381901 2006 The LIFEdb database in 2006.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...