Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
group 3 medulloblastoma 4104 2.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Duchenne muscular dystrophy 601 3.115 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.300 2.4e-04

AA Sequence

MAEGTAEAPLENGGGGDSGAGALERGVAPIKRQYLTTKEQFHQFLEAKGQEKTCRETEVGDPAGNELAEP      1 - 70
EAKRIRLEDGQTADGQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAKCFFGDR     71 - 140
CRFLHDVGRYLETKPADLGPRCVLFETFGRCPYGVTCRFAGAHLRPEGQNLVQEELAARGTQPPSIRNGL    141 - 210
DKALQQQLRKREVRFERAEQALRRFSQGPTPAAAVPEGTAAEGAPRQENCGAQQVPAGPGTSTPPSSPVR    211 - 280
TCGPLTDEDVVRLRPCEKKRLDIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEW    281 - 350
ALLKRHQCEDIFGVQLEGAFPDTMTKCAELLSRTVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQI    351 - 420
VRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQYIEECVQAAS    421 - 490
PMPLFGNGDILSFEDANRAMQTGVTGIMIARGALLKPWLFTEIKEQRHWDISSSERLDILRDFTNYGLEH    491 - 560
WGSDTQGVEKTRRFLLEWLSFLCRYVPVGLLERLPQRINERPPYYLGRDYLETLMASQKAADWIRISEML    561 - 630
LGPVPPSFAFLPKHKANAYK                                                      631 - 650
//

Text Mined References (19)

PMID Year Title