Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.02
PubTator Score 10.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma -1.231 1.5e-07
astrocytic glioma -2.200 2.7e-03
Astrocytoma, Pilocytic -1.400 5.6e-06
atypical teratoid / rhabdoid tumor -2.000 1.2e-05
Breast cancer -1.900 4.4e-10
cystic fibrosis 1.143 4.4e-04
ependymoma -2.300 5.5e-03
glioblastoma -1.300 9.3e-04
group 3 medulloblastoma -1.900 2.0e-03
intraductal papillary-mucinous adenoma (... 2.800 2.8e-03
intraductal papillary-mucinous carcinoma... 2.600 4.8e-03
lung carcinoma 3.400 6.5e-23
medulloblastoma, large-cell -2.100 2.0e-05
non-small cell lung cancer 1.524 3.8e-06
oligodendroglioma -1.900 1.3e-02
osteosarcoma 1.778 4.0e-03
Pick disease -1.600 1.5e-02
pituitary cancer 2.600 8.9e-08
primitive neuroectodermal tumor -2.000 3.7e-04
subependymal giant cell astrocytoma -2.132 1.9e-02
ulcerative colitis 1.200 4.1e-04

Gene RIF (10)

AA Sequence

MSAQRLISNRTSQQSASNSDYTWEYEYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFMFFVLTLLTKT      1 - 70
GAPHQDNAESSEKRFRMNSFVSDFGRPLEPDKVFSRQGNEESRSLFHCYINEVERLDRAKACHQTTALDS     71 - 140
DVQLQEAIRSSGQPEEELNRLMKFDIPNFVNTDQNYFGEDDLLISEPPIVLETKPLSQTSHKDLD         141 - 205
//

Text Mined References (19)

PMID Year Title