Property Summary

NCBI Gene PubMed Count 16
Grant Count 2
R01 Count 2
Funding $298,084.5
PubMed Score 11.60
PubTator Score 10.66

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96G30 A8K9M1 Q8IXM9 Q8N2D1 MC2R accessory protein 2
Symbols C6orf117
bA51G5.2

Gene

 Grant Application (2)

Pathway (1)

Gene RIF (8)

PMID Text
26469516 Data show that co-expression with MRAPalpha, but not MRAP2, enhances MC4R constitutive activity. MRAPalpha-enhanced MC4R constitutive activity is not dependent on MC4R complex glycosylation but may result from MRAPalpha-induced changes in MC4R conformational states.
25051171 MC3R is a 2-exon gene that requires a 5' UTR for translation, localization, and potential interaction with MRAP2
23869016 In a study of humans with severe, early-onset obesity, they found four rare, potentially pathogenic genetic variants in MRAP2, suggesting that the gene may also contribute to body weight regulation in humans.
23418361 Data suggest that MRAP2 regulates expression of melanocortin receptors (MC1R-MC5R); MRAP2 is highly expressed in fetal adrenal glands; MRAP2 is also expressed in hypothalamus, a site that expresses high levels of MC3R and MC4R. [REVIEW]
22419722 MRAP2 is positively regulated by ACTH and AngII in human adrenocortical tissues.
21367968 The MC2R/MRAP2 complex requires much higher concentrations of ACTH to activate compared with the MC2R/MRAP complex.
20371771 MRAP2 is an endogenous inhibitor that competes with MRAP for binding to MC2R and decreases the potency of adrenocorticotropic hormone (ACTH).
19329486 identify MRAP and MRAP2 as unique bidirectional regulators of the melanocortin receptor family

AA Sequence

MSAQRLISNRTSQQSASNSDYTWEYEYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFMFFVLTLLTKT      1 - 70
GAPHQDNAESSEKRFRMNSFVSDFGRPLEPDKVFSRQGNEESRSLFHCYINEVERLDRAKACHQTTALDS     71 - 140
DVQLQEAIRSSGQPEEELNRLMKFDIPNFVNTDQNYFGEDDLLISEPPIVLETKPLSQTSHKDLD         141 - 205
//

Text Mined References (17)

PMID Year Title
26469516 2015 hMRAP?, but Not hMRAP2, Enhances hMC4R Constitutive Activity in HEK293 Cells and This Is Not Dependent on hMRAP? Induced Changes in hMC4R Complex N-linked Glycosylation.
25051171 2014 Melanocortin 3 receptor has a 5' exon that directs translation of apically localized protein from the second in-frame ATG.
23869016 2013 Loss of function of the melanocortin 2 receptor accessory protein 2 is associated with mammalian obesity.
23418361 2013 Melanocortin receptor accessory proteins in adrenal gland physiology and beyond.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22419722 2012 Melanocortin 2 receptor-associated protein (MRAP) and MRAP2 in human adrenocortical tissues: regulation of expression and association with ACTH responsiveness.
21367968 2011 Localisation of the melanocortin-2-receptor and its accessory proteins in the developing and adult adrenal gland.
20371771 2010 Regulation of G protein-coupled receptor signaling: specific dominant-negative effects of melanocortin 2 receptor accessory protein 2.
19329486 2009 MRAP and MRAP2 are bidirectional regulators of the melanocortin receptor family.
18981183 2009 Regions of melanocortin 2 (MC2) receptor accessory protein necessary for dual topology and MC2 receptor trafficking and signaling.
More...