Property Summary

NCBI Gene PubMed Count 18
Grant Count 1
Funding $24,545.2
PubMed Score 6.20
PubTator Score 7.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
psoriasis 1.200 0.000
osteosarcoma -1.413 0.000
tuberculosis and treatment for 6 months -1.200 0.000
group 3 medulloblastoma 1.100 0.004
ovarian cancer 1.400 0.001

Synonym

Accession Q96G25 A9IZ91 A9IZ92 Q5JUY8 Q96FQ4
Symbols ARC32

Gene

 Grant Application (1)

Gene RIF (4)

PMID Text
18976975 Knockdown of MED8 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 8 (MED8) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
16973571 ability to inhibit both host transcription and the interferon response is linked to interaction of NSs with the MED8 component of Mediator, a protein complex necessary for mRNA production
12149480 mammalian mediator subunit mMED8 is an elongin BC-interacting protein that can assemble with Cul2 and Rbx1 reconstitute a ubiquitin ligase (Ubc5; E2 ubiquitin-conjugating enzyme Ubc5)

AA Sequence

MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFALLSGQLNTLNKVLKHEKTPL      1 - 70
FRNQVIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQI     71 - 140
QSLNKMCSNLLEKISKEERESESGGLRPNKQTFNPTDTNALVAAVAFGKGLSNWRPSGSSGPGQAGQPGA    141 - 210
GTILAGTSGLQQVQMAGAPSQQQPMLSGVQMAQAGQPGKMPSGIKTNIKSASMHPYQR                211 - 268
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21512757 2011 Screening and identification of host factors interacting with UL14 of herpes simplex virus 1.
21269460 2011 Initial characterization of the human central proteome.
21209843 2010 Nonsense mediated decay resistant mutations are a source of expressed mutant proteins in colon cancer cell lines with microsatellite instability.
20427562 2010 The N-terminus of Bunyamwera orthobunyavirus NSs protein is essential for interferon antagonism.
20194623 2010 MED14 tethers mediator to the N-terminal domain of peroxisome proliferator-activated receptor gamma and is required for full transcriptional activity and adipogenesis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
16973571 2006 Interaction of Bunyamwera Orthobunyavirus NSs protein with mediator protein MED8: a mechanism for inhibiting the interferon response.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...