Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.00
PubTator Score 7.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.8e-03
malignant mesothelioma 1.800 2.5e-07
osteosarcoma -1.413 1.5e-04
ovarian cancer 1.400 1.3e-03
psoriasis 1.200 8.5e-09
tuberculosis and treatment for 6 months -1.200 4.6e-06

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFALLSGQLNTLNKVLKHEKTPL      1 - 70
FRNQVIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQI     71 - 140
QSLNKMCSNLLEKISKEERESESGGLRPNKQTFNPTDTNALVAAVAFGKGLSNWRPSGSSGPGQAGQPGA    141 - 210
GTILAGTSGLQQVQMAGAPSQQQPMLSGVQMAQAGQPGKMPSGIKTNIKSASMHPYQR                211 - 268
//

Text Mined References (23)

PMID Year Title