Property Summary

NCBI Gene PubMed Count 41
PubMed Score 76.34
PubTator Score 46.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 9.4e-08
Breast cancer 1.100 1.3e-09
breast carcinoma 1.400 4.1e-05
ductal carcinoma in situ 1.100 3.2e-02
glioblastoma 1.400 8.6e-05
invasive ductal carcinoma 1.300 3.1e-03
Multiple myeloma 1.336 1.3e-03
osteosarcoma 1.178 3.9e-03
ovarian cancer 1.500 4.2e-04
pancreatic ductal adenocarcinoma liver m... -1.918 6.6e-04

Gene RIF (26)

AA Sequence

MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNI      1 - 70
KEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRF     71 - 140
TFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQI    141 - 210
IHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVIL    211 - 280
PFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSE    281 - 350
GEEAAAGGGAKSRPLANGHPILNNNHRKND                                            351 - 380
//

Text Mined References (51)

PMID Year Title