Property Summary

NCBI Gene PubMed Count 40
Grant Count 1
Funding $100,000
PubMed Score 68.17
PubTator Score 46.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.336 0.001
osteosarcoma 1.178 0.004
atypical teratoid / rhabdoid tumor 1.600 0.000
glioblastoma 1.400 0.000
pancreatic ductal adenocarcinoma liver m... -1.918 0.001
breast carcinoma 1.400 0.000
Breast cancer 1.100 0.000
ductal carcinoma in situ 1.100 0.032
invasive ductal carcinoma 1.300 0.003
ovarian cancer 1.500 0.000

Synonym

Accession Q96G23 D3DV06 Q5SZE5 Q9HD96 Q9NW79 CerS2
Symbols L3
LASS2
SP260
TMSG1

Gene

 Grant Application (1)

Gene RIF (25)

PMID Text
26887952 These results suggest that the phosphorylation of ceramide synthases may be a key regulatory point in the control of the distribution and levels of sphingolipids of various acyl-chain lengths.
26150338 these results indicate that miR-9 upregulation might be associated with malignant phenotype of bladder cancer. miR-9 promotes chemoresistance of bladder cancer cells by target LASS2.
26110566 Data show that 1-acylglycerol-3-phosphate O-acyltransferase 9 (AGPAT9) inhibit cell growth by regulating expression of KLF4/LASS2/V-ATPase proteins in breast cancer.
25973015 silencing of TMSG1 increased V-ATPase activity, decreased extracellular pH and in turn the activation of secreted MMP-2, which ultimately promoted metastasis capacity of breast cancer cell.
25735224 Results confirmed that TMSG1 is a potential metastasis suppressor gene, and suggested that the mechanism involved the induction of apoptosis and inhibition of cell proliferation via a caspase-dependent mitochondrial pathway.
25501280 the vacuolar ATPase (V-ATPase) activity and extracellular hydrogen ion concentration were significantly decreased and the activity of secreted matrix metalloproteinase-2 (MMP-2) was downregulated in MCF-7 cells overexpressing LASS2/TMSG1
25213553 Data show that CERS2 expression was markedly different between various breast cancer cells and inversely correlated with cell invasion.
24453046 the inhibitory effect of the LASS2 on growth, invasion and metastasis of prostate cancer cells
23690971 expression and role of ceramide synthase-2 in the lung
23538298 Co-expression of CerS2 with CerS4/CerS6 reversed the inhibitory effect of long chain ceramides on cell proliferation and the induction of apoptosis. we detected no effect on cell proliferation.
More...

AA Sequence

MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFLIVRYFFELYVATPLAALLNI      1 - 70
KEKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRRRNQDRPSLLKKFREASWRF     71 - 140
TFYLIAFIAGMAVIVDKPWFYDMKKVWEGYPIQSTIPSQYWYYMIELSFYWSLLFSIASDVKRKDFKEQI    141 - 210
IHHVATIILISFSWFANYIRAGTLIMALHDSSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVIL    211 - 280
PFWILHCTLVYPLELYPAFFGYYFFNSMMGVLQLLHIFWAYLILRMAHKFITGKLVEDERSDREETESSE    281 - 350
GEEAAAGGGAKSRPLANGHPILNNNHRKND                                            351 - 380
//

Text Mined References (50)

PMID Year Title
26887952 2016 Enzyme Activities of the Ceramide Synthases CERS2-6 Are Regulated by Phosphorylation in the C-terminal Region.
26150338 2015 miR-9 promotes cell proliferation and inhibits apoptosis by targeting LASS2 in bladder cancer.
26110566 2015 AGPAT9 suppresses cell growth, invasion and metastasis by counteracting acidic tumor microenvironment through KLF4/LASS2/V-ATPase signaling pathway in breast cancer.
25973015 2015 Silencing of TMSG1 enhances metastasis capacity by targeting V-ATPase in breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25735224 2015 Overexpression of a Novel Tumor Metastasis Suppressor Gene TMSG1/LASS2 Induces Apoptosis via a Caspase-dependent Mitochondrial Pathway.
25501280 2015 LASS2/TMSG1 inhibits growth and invasion of breast cancer cell in vitro through regulation of vacuolar ATPase activity.
25213553 2015 CERS2 suppresses tumor cell invasion and is associated with decreased V-ATPase and MMP-2/MMP-9 activities in breast cancer.
24453046 2014 Silencing of LASS2/TMSG1 enhances invasion and metastasis capacity of prostate cancer cell.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
More...