Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 19.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.0e-06
psoriasis 6694 1.1e-03
Multiple myeloma 1332 8.0e-03
non primary Sjogren syndrome sicca 891 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.048 8.0e-03
non primary Sjogren syndrome sicca 1.100 4.7e-02
ovarian cancer 2.000 4.0e-06
psoriasis 1.200 1.1e-03

 GO Process (1)

AA Sequence

MLRREARLRREYLYRKAREEAQRSAQERKERLRRALEENRLIPTELRREALALQGSLEFDDAGGEGVTSH      1 - 70
VDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRGRHEVGALVRACKANGVTDLLVVH     71 - 140
EHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSRLGKRVSDILRYLFPVP    141 - 210
KDDSHRVITFANQDDYISFRHHVYKKTDHRNVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTN    211 - 280
TARKRVFLSTE                                                               281 - 291
//

Text Mined References (15)

PMID Year Title