Property Summary

NCBI Gene PubMed Count 21
Grant Count 1
Funding $43,262.38
PubMed Score 74.64
PubTator Score 57.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma 1.700 0.000
osteosarcoma -1.168 0.038
posterior fossa group A ependymoma 1.400 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.040
pediatric high grade glioma 1.400 0.000
pilocytic astrocytoma 1.800 0.000
sonic hedgehog group medulloblastoma 1.200 0.001
psoriasis 1.800 0.000
gastric carcinoma 1.500 0.014
ductal carcinoma in situ 1.200 0.000
ovarian cancer -1.200 0.000
Breast cancer 1.200 0.000
pituitary cancer -1.200 0.002

Synonym

Accession Q96G03 B4E0G8 Q53FP5 Q5QTR0 Q9H0P9 Q9NV22 PGM 2
Symbols MSTP006

Gene

PANTHER Protein Class (2)

 Grant Application (1)

 MGI Term (1)

Gene RIF (1)

PMID Text
17804405 In the present work, phosphopentomutase was purified from human erythrocytes and found it to copurify with a 68-kDa polypeptide that was identified by mass spectrometry as PGM2, sharing about 20% identity with mammalian phosphoglucomutase 1.

AA Sequence

MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGI      1 - 70
SRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFISQGIPVYLFSD     71 - 140
ITPTPFVPFTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDKGISQAIEENLEPWPQAWDDS    141 - 210
LIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKFVHTSVHGVGHSFVQSAFKAFDLVPPEAVPE    211 - 280
QKDPDPEFPTVKYPNPEEGKGVLTLSFALADKTKARIVLANDPDADRLAVAEKQDSGEWRVFSGNELGAL    281 - 350
LGWWLFTSWKEKNQDRSALKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVL    351 - 420
FAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHITKASYFICHDQETI    421 - 490
KKLFENLRNYDGKNNYPKACGKFEISAIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTS    491 - 560
GTEPKIKYYAELCAPPGNSDPEQLKKELNELVSAIEEHFFQPQKYNLQPKAD                      561 - 612
//

Text Mined References (30)

PMID Year Title
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...