Property Summary

NCBI Gene PubMed Count 21
PubMed Score 73.57
PubTator Score 57.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.300 1.4e-03
Astrocytoma, Pilocytic 1.100 1.2e-06
Breast cancer 1.200 4.5e-05
ductal carcinoma in situ 1.200 3.4e-04
ependymoma 1.300 8.9e-08
gastric carcinoma 1.500 1.4e-02
glioblastoma 1.200 8.4e-05
intraductal papillary-mucinous neoplasm ... 1.100 4.0e-02
osteosarcoma -1.168 3.8e-02
ovarian cancer -1.200 1.4e-06
pituitary cancer -1.200 1.5e-03
psoriasis 1.400 2.0e-40
sonic hedgehog group medulloblastoma 1.200 1.4e-03

 MGI Phenotype (1)

Gene RIF (1)

AA Sequence

MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGI      1 - 70
SRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFISQGIPVYLFSD     71 - 140
ITPTPFVPFTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDKGISQAIEENLEPWPQAWDDS    141 - 210
LIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKFVHTSVHGVGHSFVQSAFKAFDLVPPEAVPE    211 - 280
QKDPDPEFPTVKYPNPEEGKGVLTLSFALADKTKARIVLANDPDADRLAVAEKQDSGEWRVFSGNELGAL    281 - 350
LGWWLFTSWKEKNQDRSALKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVL    351 - 420
FAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHITKASYFICHDQETI    421 - 490
KKLFENLRNYDGKNNYPKACGKFEISAIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTS    491 - 560
GTEPKIKYYAELCAPPGNSDPEQLKKELNELVSAIEEHFFQPQKYNLQPKAD                      561 - 612
//

Text Mined References (30)

PMID Year Title