Property Summary

NCBI Gene PubMed Count 35
PubMed Score 35.11
PubTator Score 18.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
pancreatic cancer 1.200 1.7e-04
active ulcerative colitis 1.797 1.7e-02
adrenocortical carcinoma 1.194 5.7e-03
Alzheimer's disease 1.100 2.3e-02
astrocytic glioma -1.300 4.3e-03
atypical teratoid / rhabdoid tumor 1.400 1.6e-04
Breast cancer -1.200 1.0e-04
chronic lymphosyte leukemia 1.100 2.4e-03
colon cancer 1.300 5.0e-02
ependymoma -1.600 4.2e-09
gastric cancer 1.100 1.9e-03
glioblastoma 1.300 2.5e-06
group 3 medulloblastoma 1.700 9.2e-03
intraductal papillary-mucinous adenoma (... 1.300 2.1e-02
intraductal papillary-mucinous carcinoma... 1.100 2.1e-02
intraductal papillary-mucinous neoplasm ... 3.300 2.8e-05
lung carcinoma 1.300 3.5e-18
medulloblastoma, large-cell 2.300 2.9e-06
non primary Sjogren syndrome sicca -1.200 2.7e-02
non-small cell lung cancer 1.387 1.4e-11
osteosarcoma 1.168 3.5e-02
ovarian cancer 2.400 5.6e-05
pediatric high grade glioma 1.500 6.7e-05
Pick disease 1.100 2.3e-04
primitive neuroectodermal tumor 1.500 4.7e-05
sarcoidosis 1.100 5.4e-03

Gene RIF (15)

AA Sequence

MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDSLKQELEQLK      1 - 70
EAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLGKILEMQNELKQSRAVVTNVQAENERLTAVVQDL     71 - 140
KENNEMVELQRIRMKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEET    141 - 210
VLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYISLNDNHISISVDGLKFAEDGSEPN    211 - 280
NDDKMNGHIHGPLVKLNGDYRTPTLRKGESLNPVSDLFSELNISEIQKLKQQLMQVEREKAILLANLQES    281 - 350
QTQLEHTKGALTEQHERVHRLTEHVNAMRGLQSSKELKAELDGEKGRDSGEEAHDYEVDINGLEILECKY    351 - 420
RVAVTEVIDLKAEIKALKEKYNKSVENYTDEKAKYESKIQMYDEQVTSLEKTTKESGEKMAHMEKELQKM    421 - 490
TSIANENHSTLNTAQDELVTFSEELAQLYHHVCLCNNETPNRVMLDYYRQSRVTRSGSLKGPDDPRGLLS    491 - 560
PRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKEPMNIYNLNA    561 - 630
IIRDQIKHLQKAVDRSLQLSRQRAAARELAPMIDKDKEALMEEILKLKSLLSTKREQIATLRAVLKANKQ    631 - 700
TAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAE    701 - 770
DEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQSRRSKGKLGKSKIGSPKVSGEASVTVPTIDTYLLHSQ    771 - 840
GPQTPNIRVSSGTQRKRQFSPSLCDQSRPRTSGASYLQNLLRVPPDPTSTESFLLKGPPSMSEFIQGHRL    841 - 910
SKEKRLTVAPPDCQQPAASVPPQCSQLAGRQDCPTVSPDTALPEEQPHSSSQCAPLHCLSKPPHP         911 - 975
//

Text Mined References (37)

PMID Year Title