Property Summary

NCBI Gene PubMed Count 29
Grant Count 14
R01 Count 13
Funding $864,656
PubMed Score 33.52
PubTator Score 18.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
25792135 Graft BICD1 polymorphisms apart from the association with telomere length, affect early kidney function after transplantation
20709820 Variants in BICD1 are associated with length of telomeres, which suggests that a mechanism linked to accelerated aging may be involved in the pathogenesis of emphysema.
20709820 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20686608 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20164183 the protease-activated receptor-1 interactor, Bicaudal D1, regulates G protein signaling and internalization
20080650 Observational study of gene-disease association. (HuGE Navigator)
18487243 BICD1 plays a similar role in telomere length homeostasis in humans.
17707369 The brain-specific Rab6B via Bicaudal-D1 is linked to the dynein/dynactin complex, suggesting a regulatory role for Rab6B in the retrograde transport of cargo in neuronal cells.
17139249 These results imply that GSK-3beta may function in transporting centrosomal proteins to the centrosome by stabilizing the BICD1 and dynein complex, resulting in the regulation of a focused microtubule organization.
More...

AA Sequence

MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDSLKQELEQLK      1 - 70
EAFGQSFSIHRKVAEDGETREETLLQESASKEAYYLGKILEMQNELKQSRAVVTNVQAENERLTAVVQDL     71 - 140
KENNEMVELQRIRMKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEET    141 - 210
VLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYISLNDNHISISVDGLKFAEDGSEPN    211 - 280
NDDKMNGHIHGPLVKLNGDYRTPTLRKGESLNPVSDLFSELNISEIQKLKQQLMQVEREKAILLANLQES    281 - 350
QTQLEHTKGALTEQHERVHRLTEHVNAMRGLQSSKELKAELDGEKGRDSGEEAHDYEVDINGLEILECKY    351 - 420
RVAVTEVIDLKAEIKALKEKYNKSVENYTDEKAKYESKIQMYDEQVTSLEKTTKESGEKMAHMEKELQKM    421 - 490
TSIANENHSTLNTAQDELVTFSEELAQLYHHVCLCNNETPNRVMLDYYRQSRVTRSGSLKGPDDPRGLLS    491 - 560
PRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKEPMNIYNLNA    561 - 630
IIRDQIKHLQKAVDRSLQLSRQRAAARELAPMIDKDKEALMEEILKLKSLLSTKREQIATLRAVLKANKQ    631 - 700
TAEVALANLKNKYENEKAMVTETMTKLRNELKALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAE    701 - 770
DEKKTLNTLLRMAIQQKLALTQRLEDLEFDHEQSRRSKGKLGKSKIGSPKVSGEASVTVPTIDTYLLHSQ    771 - 840
GPQTPNIRVSSGTQRKRQFSPSLCDQSRPRTSGASYLQNLLRVPPDPTSTESFLLKGPPSMSEFIQGHRL    841 - 910
SKEKRLTVAPPDCQQPAASVPPQCSQLAGRQDCPTVSPDTALPEEQPHSSSQCAPLHCLSKPPHP         911 - 975
//

Text Mined References (31)

PMID Year Title
25792135 2015 hTERT, BICD1 and chromosome 18 polymorphisms associated with telomere length affect kidney allograft function after transplantation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20709820 2011 Genome-wide association study identifies BICD1 as a susceptibility gene for emphysema.
20686608 2010 Genome-wide association study of pancreatic cancer in Japanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20164183 2010 A novel protease-activated receptor-1 interactor, Bicaudal D1, regulates G protein signaling and internalization.
20089649 2010 Bicaudal D1-dependent trafficking of human cytomegalovirus tegument protein pp150 in virus-infected cells.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
More...