Property Summary

NCBI Gene PubMed Count 32
Grant Count 8
Funding $490,312.26
PubMed Score 22.54
PubTator Score 12.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.200 0.000
ovarian cancer 1.100 0.000

 GO Function (1)

Gene RIF (8)

PMID Text
25588614 Purified VPS-20 exhibits an open extended conformation, irrespective of ESCRT-II binding.
25232011 Taken together, these data suggest an active role for ESCRT-II and CHMP6 in ESCRT-mediated abscission
22231449 silencing CHMP6 and VPS4A also blocked epidermal growth factor receptor (EGFR) recycling
21762798 A fragment (amino acids 1-167) of CHMP6 is a potent dominant negative inhibitor of HIV-1 Gag release from cells
19686684 Results describe the mapping of multivesicular bodies with the second winged helix domain of human ESCRT-II subunit VPS25 and the first helix of ESCRT-III subunit VPS20.
19270365 In this study, we found that overexpression of chromatin modifying protein 6 (CHMP6) induced cell death by a series of experiments.
18723511 A fragment (amino acids 1-167) of CHMP6 is a potent dominant negative inhibitor of HIV-1 Gag release from cells
18723511 A fragment (amino acids 1-167) of CHMP6 is a potent dominant negative inhibitor of HIV-1 Gag release from cells

AA Sequence

MGNLFGRKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERAKLLLKKKRYQ      1 - 70
EQLLDRTENQISSLEAMVQSIEFTQIEMKVMEGLQFGNECLNKMHQVMSIEEVERILDETQEAVEYQRQI     71 - 140
DELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPEKIPENVPVKARPRQAELVAAS             141 - 201
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25588614 2015 The VPS-20 subunit of the endosomal sorting complex ESCRT-III exhibits an open conformation in the absence of upstream activation.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25232011 2014 Inhibition of ESCRT-II-CHMP6 interactions impedes cytokinetic abscission and leads to cell death.
24878737 2014 Structure of cellular ESCRT-III spirals and their relationship to HIV budding.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22231449 2012 CHMP6 and VPS4A mediate the recycling of Ras to the plasma membrane to promote growth factor signaling.
More...