Property Summary

NCBI Gene PubMed Count 32
PubMed Score 22.30
PubTator Score 12.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 6.5e-05
psoriasis 6694 1.8e-04
Disease Target Count Z-score Confidence
Kaposi's sarcoma 22 3.117 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 6.5e-05
psoriasis 1.200 1.8e-04

 MGI Phenotype (1)

Gene RIF (7)

AA Sequence

MGNLFGRKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERAKLLLKKKRYQ      1 - 70
EQLLDRTENQISSLEAMVQSIEFTQIEMKVMEGLQFGNECLNKMHQVMSIEEVERILDETQEAVEYQRQI     71 - 140
DELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPEKIPENVPVKARPRQAELVAAS             141 - 201
//

Text Mined References (38)

PMID Year Title