Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.24
PubTator Score 7.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -2.500 2.7e-12
chronic lymphosyte leukemia -1.600 1.3e-14
cystic fibrosis 1.022 8.5e-05
lung carcinoma -2.000 6.6e-34
ovarian cancer 1.500 6.2e-04
pancreatic cancer 1.200 1.1e-02
pancreatic ductal adenocarcinoma liver m... 1.346 5.6e-03
tuberculosis 1.100 1.4e-07
ulcerative colitis 1.600 1.3e-05

Gene RIF (6)

AA Sequence

MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTN      1 - 70
YSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGL     71 - 140
VAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV                                       141 - 175
//

Text Mined References (11)

PMID Year Title