Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.24
PubTator Score 7.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Heart failure 80
Disease Target Count P-value
lung carcinoma 2844 6.59153290027945E-34
chronic lymphosyte leukemia 232 1.3112342468554E-14
Breast cancer 3099 2.68933367894044E-12
tuberculosis 1563 1.43235061750753E-7
ulcerative colitis 2087 1.33364536228085E-5
cystic fibrosis 1670 8.45392734272294E-5
ovarian cancer 8492 6.19363855311106E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00564202361397874
pancreatic cancer 2300 0.0110801552749835
Disease Target Count Z-score Confidence
Congestive heart failure 36 0.0 2.0

Expression

  Differential Expression (9)

Disease log2 FC p
chronic lymphosyte leukemia -1.600 0.000
cystic fibrosis 1.022 0.000
pancreatic ductal adenocarcinoma liver m... 1.346 0.006
tuberculosis 1.100 0.000
Breast cancer -2.500 0.000
lung carcinoma -2.000 0.000
ulcerative colitis 1.600 0.000
ovarian cancer 1.500 0.001
pancreatic cancer 1.200 0.011

Synonym

Accession Q96FZ5 Q5VLK1
Symbols CKLFSF7

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (6)

PMID Text
26528697 Findings indicate the role of CMTM7 protein in the regulation of epidermal growth factor receptor (EGFR)-AKT proto-oncogene protein signaling in tumor cells, and as a molecule related to Rab5 GTP-binding protein activation.
23981602 The CMTM7 expression may be related to survival of patients with non-smallcell lung cancer and a unique prognostic factor. CMTM7 may play an important role in NSCLC development.
23893243 Loss of CMTM7 by promoter CpG methylation is associated with neoplasms.
22363743 CMTM7 functions to link sIgM and BLNK in the plasma membrane.
20400778 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
12782130 Bioinformatics based on CKLF2 cDNA and protein sequences in combination with experimental validation identified CKLFSF1-8 gene clusters, between the SCY and the TM4SF gene families. The 8 family members were cloned and characterized.

AA Sequence

MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTN      1 - 70
YSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGL     71 - 140
VAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV                                       141 - 175
//

Text Mined References (11)

PMID Year Title
26528697 2015 CMTM7 knockdown increases tumorigenicity of human non-small cell lung cancer cells and EGFR-AKT signaling by reducing Rab5 activation.
23981602 2013 Change of CMTM7 expression, a potential tumor suppressor, is associated with poor clinical outcome in human non-small cell lung cancer.
23893243 2014 A novel 3p22.3 gene CMTM7 represses oncogenic EGFR signaling and inhibits cancer cell growth.
22363743 2012 Identification of CMTM7 as a transmembrane linker of BLNK and the B-cell receptor.
20400778 2010 Genomic variation associated with mortality among adults of European and African ancestry with heart failure: the cohorts for heart and aging research in genomic epidemiology consortium.
19946888 2010 Defining the membrane proteome of NK cells.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12782130 2003 Identification of eight genes encoding chemokine-like factor superfamily members 1-8 (CKLFSF1-8) by in silico cloning and experimental validation.
More...