Property Summary

NCBI Gene PubMed Count 13
Grant Count 13
Funding $3,590,210.89
PubMed Score 22.88
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
astrocytic glioma -1.100 0.017
ependymoma -1.400 0.027
osteosarcoma -1.646 0.000
subependymal giant cell astrocytoma -1.212 0.005
ovarian cancer 1.300 0.000
pituitary cancer 1.100 0.000

Gene RIF (5)

PMID Text
26356709 5-hmC might be involved in the pathogenesis of Nonalcoholic Fatty Liver Disease by regulating liver mitochondrial biogenesis and PPARGC1A expression.
25827305 The expression of 5-hmC was an independent prognostic factor for overall survival of EOC [epithelial ovarian canc] patients.
25471351 The findings of this study described in this study emphasise the importance of 5hmC in brain development and ageing and will help to better understand the complexity and plasticity of the brain.
24679604 Its reduction in brain is associate with neuropathology of Alzheimer disease.
24387984 It involves in epigenetic changes during the progression of Alzheimer disease pathology.

AA Sequence

MCGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERII      1 - 70
APMRWGLVPSWFKESDPSKLQFNTTNCRSDTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPY     71 - 140
FIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIH    141 - 210
HRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRA    211 - 280
SGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKREKEEEPVAKR    281 - 350
PYSQ                                                                      351 - 354
//

Text Mined References (18)

PMID Year Title
26356709 2015 Epigenetic Modifications in the Biology of Nonalcoholic Fatty Liver Disease: The Role of DNA Hydroxymethylation and TET Proteins.
25827305 2015 Prognostic values of 5-hmC, 5-mC and TET2 in epithelial ovarian cancer.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25471351 2015 5-Hydroxymethylcytosine, the "Sixth Base", during brain development and ageing.
24679604 2014 Cross-region reduction in 5-hydroxymethylcytosine in Alzheimer's disease brain.
24387984 2014 Global changes in DNA methylation and hydroxymethylation in Alzheimer's disease human brain.
23945014 2013 Novel autoproteolytic and DNA-damage sensing components in the bacterial SOS response and oxidized methylcytosine-induced eukaryotic DNA demethylation systems.
23434322 2013 Dynamic readers for 5-(hydroxy)methylcytosine and its oxidized derivatives.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
More...