Property Summary

NCBI Gene PubMed Count 29
Grant Count 61
R01 Count 43
Funding $4,708,423.35
PubMed Score 219.58
PubTator Score 22.47

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96FX8 B2RB73 E1P590 Q8IWS3 Q8N1J6 Q8NC16 Q9H1C5 Q9H230
Symbols THW
KCP1
PIGPC1
KRTCAP1
dJ496H19.1

Gene

Gene RIF (17)

PMID Text
25486861 The authors identified the tetraspanning membrane protein, p53 effector related to PMP-22 (PERP), as a Salmonella typhimurium SipA binding partner.
24066004 Decreased PERP expression on peripheral blood mononuclear cells from patient with rheumatoid arthritis negatively correlates with disease activity.
23333304 HIV-1 Vif upregulates the expression of TP53 apoptosis effector (PERP) in Vif-expression T cells
22515648 Perp expression is reduced in human breast cancer cell lines
21451571 PERP expression stabilizes active p53 via modulation of p53-MDM2 interaction in uveal melanoma cells.
21254927 Our comprehensive mutation scanning did not identify any Arrhythmogenic right ventricular cardiomyopathy (ARVC) causing mutations.
20975948 Data suggest a temporal sequence whereby PERP loss occurs before E-cadherin loss in the progression of human SCC.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLME      1 - 70
YAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLH     71 - 140
ANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA                     141 - 193
//

Text Mined References (29)

PMID Year Title
25486861 2015 PERP, a host tetraspanning membrane protein, is required for Salmonella-induced inflammation.
24066004 2013 Decreased PERP expression on peripheral blood mononuclear cells from patient with rheumatoid arthritis negatively correlates with disease activity.
23568457 2013 Genetic variants associated with disordered eating.
22515648 2012 Deficiency of the p53/p63 target Perp alters mammary gland homeostasis and promotes cancer.
21451571 2011 PERP expression stabilizes active p53 via modulation of p53-MDM2 interaction in uveal melanoma cells.
21254927 2011 Screening of three novel candidate genes in arrhythmogenic right ventricular cardiomyopathy.
20975948 2010 Loss of the p53/p63 regulated desmosomal protein Perp promotes tumorigenesis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
More...