Property Summary

NCBI Gene PubMed Count 32
PubMed Score 224.20
PubTator Score 22.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (33)

Disease log2 FC p
acute quadriplegic myopathy 1.426 6.0e-08
adult high grade glioma -1.100 3.9e-02
aldosterone-producing adenoma -1.347 4.1e-02
autosomal dominant Emery-Dreifuss muscul... 1.424 1.9e-03
Becker muscular dystrophy 1.073 1.1e-02
Breast cancer -2.200 2.4e-13
colon cancer 1.400 1.5e-02
cystic fibrosis 3.698 9.4e-08
Duchenne muscular dystrophy 1.539 2.7e-10
ductal carcinoma in situ 1.600 3.0e-02
Endometriosis -1.130 1.9e-02
ependymoma 1.300 2.5e-03
esophageal adenocarcinoma -1.700 3.9e-02
gastric cancer 1.100 7.5e-03
glioblastoma 1.300 3.4e-02
group 4 medulloblastoma -1.300 2.3e-02
interstitial cystitis -2.100 4.3e-04
intraductal papillary-mucinous adenoma (... 1.600 7.6e-03
intraductal papillary-mucinous carcinoma... 1.800 2.5e-03
intraductal papillary-mucinous neoplasm ... 1.400 3.6e-02
limb girdle muscular dystrophy 2A 1.067 6.3e-06
lung adenocarcinoma 2.654 2.6e-09
lung cancer 2.100 5.6e-05
malignant mesothelioma -1.800 4.3e-07
non-small cell lung cancer 2.599 2.4e-19
osteosarcoma 1.589 3.8e-02
ovarian cancer 1.400 7.5e-04
pancreatic cancer 1.300 1.0e-06
primary pancreatic ductal adenocarcinoma 1.824 8.3e-03
primitive neuroectodermal tumor -1.300 2.6e-02
psoriasis 1.100 2.1e-10
spina bifida -2.221 4.4e-02
tuberculosis -2.000 4.6e-07

Gene RIF (20)

AA Sequence

MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLME      1 - 70
YAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLH     71 - 140
ANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA                     141 - 193
//

Text Mined References (32)

PMID Year Title