Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
R01 Count 4
Funding $202,605.33
PubMed Score 17.70
PubTator Score 6.98

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96FX2
Symbols DESR1
DPH3A
KTI11
ZCSL2
DELGIP
DELGIP1

Gene

PDB

2JR7  

Gene RIF (3)

PMID Text
26416425 The results from this study show occurrence of frequent somatic non-coding mutations adjacent to a pre-existing binding site for Ets transcription factors within the directional promoter of DPH3 and OXNAD1 genes in three major skin cancers.
18214955 Solution structure of human DESR1, a CSL zinc-binding protein.
14980502 DelGIP1is a binding partner of deafness locus putative guanine nucleotide exchange factor; downregulation of DelGIP1 induced increased extracellular secretion of proteoglycans indicating a possible role for DelGIP1 in the secretion process

AA Sequence

MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETV      1 - 70
PAPSANKELVKC                                                               71 - 82
//

Text Mined References (12)

PMID Year Title
26416425 2015 Frequent DPH3 promoter mutations in skin cancers.
25416956 2014 A proteome-scale map of the human interactome network.
18214955 2008 Solution structure of human DESR1, a CSL zinc-binding protein.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16648478 2006 Dph3, a small protein required for diphthamide biosynthesis, is essential in mouse development.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485916 2004 Identification of the proteins required for biosynthesis of diphthamide, the target of bacterial ADP-ribosylating toxins on translation elongation factor 2.
14980502 2004 Characterisation of an evolutionary conserved protein interacting with the putative guanine nucleotide exchange factor DelGEF and modulating secretion.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...