Property Summary

NCBI Gene PubMed Count 37
Grant Count 27
R01 Count 15
Funding $1,612,743.77
PubMed Score 43.19
PubTator Score 28.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
osteosarcoma 1.326 0.000
lung cancer 1.100 0.009
subependymal giant cell astrocytoma -1.138 0.012
Pick disease -1.100 0.000
ovarian cancer 1.700 0.000

Gene RIF (20)

PMID Text
26752685 substrate for hydroxylation by FIH on N22
26148240 the data suggest that OTUB1 limits the ubiquitination and degradation of FOXM1 in breast cancer and has a key role in genotoxic agent resistance.
25874870 HIV-1 Nef downregulates the expression of ubiquitin thioesterase (OTUB1) protein in Nef-transfected SupT1 cells
25872870 Data show that casein kinase 2 (CK2)-mediated phosphorylation of deubiquitylating enzyme OTUB1 at Ser16 causes nuclear accumulation of OTUB1.
25431208 OTUB1 promoted the metastasis of CRC cell lines.
24763515 After viral infection, HSCARG interacted with tumor necrosis receptor-associated factor 3 (TRAF3) and inhibited its ubiquitination by promoting the recruitment of OTUB1 to TRAF3.
24403071 These data reveal novel insights into the Otub1 inhibition of E2 wherein monoubiquitination promotes the interaction of Otub1 with UbcH5 and the function to suppress it.
24071738 OTUB1 enhances TGF-beta signaling by inhibiting the ubiquitylation and degradation of active SMAD2 and SMAD3.
23955022 A second role of OTUB1-E2 interactions is to stimulate OTUB1 cleavage of Lys48 polyubiquitin. This stimulation is regulated by the ratio of charged to uncharged E2 and by the concentration of Lys48-linked polyubiquitin and free ubiquitin.
23524849 These results suggest that OTUB1 regulates NF-kappaB and MAPK signalling pathways and TNF-dependent cell death by modulating c-IAP1 stability.
More...

AA Sequence

MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQ      1 - 70
KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHN     71 - 140
TFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEP    141 - 210
MCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK             211 - 271
//

Text Mined References (43)

PMID Year Title
26752685 2016 FIH Regulates Cellular Metabolism through Hydroxylation of the Deubiquitinase OTUB1.
26148240 2016 OTUB1 inhibits the ubiquitination and degradation of FOXM1 in breast cancer and epirubicin resistance.
25872870 2015 Casein kinase 2 (CK2) phosphorylates the deubiquitylase OTUB1 at Ser16 to trigger its nuclear localization.
25431208 2014 OTUB1 promotes metastasis and serves as a marker of poor prognosis in colorectal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24763515 2014 HSCARG negatively regulates the cellular antiviral RIG-I like receptor signaling pathway by inhibiting TRAF3 ubiquitination via recruiting OTUB1.
24403071 2014 Monoubiquitination is critical for ovarian tumor domain-containing ubiquitin aldehyde binding protein 1 (Otub1) to suppress UbcH5 enzyme and stabilize p53 protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24071738 2013 OTUB1 enhances TGF? signalling by inhibiting the ubiquitylation and degradation of active SMAD2/3.
23955022 2013 E2 ubiquitin-conjugating enzymes regulate the deubiquitinating activity of OTUB1.
More...