Property Summary

NCBI Gene PubMed Count 42
PubMed Score 49.98
PubTator Score 28.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.6e-08
ovarian cancer 8520 4.3e-06
malignant mesothelioma 3232 4.5e-06
Pick disease 1894 2.2e-04
lung cancer 4740 8.9e-03
subependymal giant cell astrocytoma 2287 1.2e-02
Disease Target Count Z-score Confidence
Retinitis pigmentosa 14 7 4.477 2.2

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.100 8.9e-03
malignant mesothelioma 1.600 4.5e-06
osteosarcoma 1.326 4.6e-08
ovarian cancer 1.700 4.3e-06
Pick disease -1.100 2.2e-04
subependymal giant cell astrocytoma -1.138 1.2e-02

Gene RIF (24)

AA Sequence

MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQ      1 - 70
KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHN     71 - 140
TFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEP    141 - 210
MCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK             211 - 271
//

Text Mined References (48)

PMID Year Title