Property Summary

NCBI Gene PubMed Count 38
Grant Count 5
R01 Count 5
Funding $1,789,368
PubMed Score 23.27
PubTator Score 117.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
group 3 medulloblastoma 1.100 0.001

Synonym

Accession Q96FV9 B2RBP6 Q15219 Q64I72 Q64I73 Tho1
Symbols P84
HPR1
P84N5

Gene

PANTHER Protein Class (1)

PDB

1WXP  

Gene RIF (13)

PMID Text
26545775 Colorectal cancer patients with high levels of Thoc1 expression had poorer overall-survival and disease-free survival, whereas those with lower levels of Thoc1 expression survived longer.
25296641 In humans, high THOC1 protein expression associates with prostate cancer aggressiveness and recurrence. Thus, THOC1 protein is a molecular marker that may improve the identification of aggressive prostate cancers, potentially reducing overtreatment.
24682263 Thoc1 inhibits cell growth via induction of cell cycle arrest and apoptosis in lung cancer cells.
23460917 This suggests NEDD4-1 functions in conjunction with other post-translational mechanisms to regulate Thoc1 protein and THO activity.
22952718 overexpression of hTREX84 is associated with cancer cell transformation, proliferation and may be regulated by RelA/p65
22144908 We show that human THO depletion impairs transcription elongation and mRNA export and increases instability associated with DNA breaks, leading to hyper-recombination and gammaH2AX and 53BP1 foci accumulation
21329510 A differential connection between tumorogenesis and the expression levels of human THO and ALY.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18469354 elevated expression of hHpr1/p84/Thoc1 is common in NSCLC and may have prognostic significance in subgroups of patients
17699767 Cells respond to AAV infection by activating two DNA damage signaling cascades. The first activates the p84N5 protein, which in turn activates caspase-6, leading to cell death.
More...

AA Sequence

MSPTPPLFSLPEARTRFTKSTREALNNKNIKPLLSTFSQVPGSENEKKCTLDQAFRGILEEEIINHSSCE      1 - 70
NVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMC     71 - 140
NDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGM    141 - 210
DVEEGEMGDEEAPTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKLDDTQ    211 - 280
ASRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQS    281 - 350
LWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRIIRKRTAPE    351 - 420
DFLGKGPTKKILMGNEELTRLWNLCPDNMEACKSETREHMPTLEEFFEEAIEQADPENMVENEYKAVNNS    421 - 490
NYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES    491 - 560
PDVRRDKPVTGEQIEVFANKLGEQWKILAPYLEMKDSEIRQIECDSEDMKMRAKQLLVAWQDQEGVHATP    561 - 630
ENLINALNKSGLSDLAESLTNDNETNS                                               631 - 657
//

Text Mined References (53)

PMID Year Title
26545775 2015 Elevated expression of Thoc1 is associated with aggressive phenotype and poor prognosis in colorectal cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25296641 2014 The Thoc1 ribonucleoprotein and prostate cancer progression.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24682263 2014 Thoc1 inhibits cell growth via induction of cell cycle arrest and apoptosis in lung cancer cells.
More...