Property Summary

NCBI Gene PubMed Count 39
PubMed Score 23.22
PubTator Score 117.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 3.4e-06
group 3 medulloblastoma 4104 9.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 0.9

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.100 9.1e-04
malignant mesothelioma 1.300 3.4e-06

Protein-protein Interaction (4)

Gene RIF (14)

AA Sequence

MSPTPPLFSLPEARTRFTKSTREALNNKNIKPLLSTFSQVPGSENEKKCTLDQAFRGILEEEIINHSSCE      1 - 70
NVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMC     71 - 140
NDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGM    141 - 210
DVEEGEMGDEEAPTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKLDDTQ    211 - 280
ASRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQS    281 - 350
LWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRIIRKRTAPE    351 - 420
DFLGKGPTKKILMGNEELTRLWNLCPDNMEACKSETREHMPTLEEFFEEAIEQADPENMVENEYKAVNNS    421 - 490
NYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES    491 - 560
PDVRRDKPVTGEQIEVFANKLGEQWKILAPYLEMKDSEIRQIECDSEDMKMRAKQLLVAWQDQEGVHATP    561 - 630
ENLINALNKSGLSDLAESLTNDNETNS                                               631 - 657
//

Text Mined References (55)

PMID Year Title