Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.7e-02
chronic rhinosinusitis -1.932 2.0e-02
ependymoma 2.200 1.1e-06
lung carcinoma -1.200 4.2e-03
nasopharyngeal carcinoma -1.800 5.6e-05

Synonym

Accession Q96FV0 A8K9Q0
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

AA Sequence

MSGGKSAQGPEEGGVCITEALITKRNLTFPEDGELSEKMFHTLDELQTVRLDREGITTIRNLEGLQNLHS      1 - 70
LYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSENLIETLKLDEFPQSLLILNLS     71 - 140
GNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSDEEFPELSGPFCSERGFLKELEQELSR    141 - 210
HREHRQQTALTEHLLRMEMQPTLTDLPLLPGVPMAGDSSPSATPAQGEETVPEAVSSPQASSPTKKPCSL    211 - 280
IPRGHQSSFWGRKGARAATAPKASVAEAPSTTKTTAKRSKK                                 281 - 321
//

Text Mined References (7)

PMID Year Title