Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.25146350389241E-15
nasopharyngeal carcinoma 1056 3.85075554090322E-7
lung carcinoma 2844 0.00424089513455599
chronic rhinosinusitis 512 0.0197055042192155
atypical teratoid / rhabdoid tumor 4369 0.027231690153281


  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 4.700 0.000
atypical teratoid / rhabdoid tumor 1.200 0.027
nasopharyngeal carcinoma -2.600 0.000
lung carcinoma -1.200 0.004
chronic rhinosinusitis -1.932 0.020


Accession Q96FV0 A8K9Q0


  Ortholog (9)

AA Sequence

IPRGHQSSFWGRKGARAATAPKASVAEAPSTTKTTAKRSKK                                 281 - 321

Text Mined References (7)

PMID Year Title
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.