Property Summary

NCBI Gene PubMed Count 13
Grant Count 112
R01 Count 83
Funding $10,101,909.25
PubMed Score 141.01
PubTator Score 35.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96FT9 B3KPT6 B4DZI9 G3V385 O95418 Q9ULA9
Symbols CED3
C14orf179

Gene

Gene RIF (2)

PMID Text
26740177 These results suggest that CED-4 forms a complex with ced-3 mRNA and delivers it to ribosomes for translation.
21378380 C14ORF179 encoding IFT43 is mutated in Sensenbrenner syndrome.

AA Sequence

MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKA      1 - 70
SKFRRKASEEIEDFRLRPQSLNGSDYGGDIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLM     71 - 140
KYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT      141 - 208
//

Text Mined References (17)

PMID Year Title
26740177 2016 CED-4 is an mRNA-binding protein that delivers ced-3 mRNA to ribosomes.
25416956 2014 A proteome-scale map of the human interactome network.
24236485 2013 Genome-wide association study in NSAID-induced acute urticaria/angioedema in Spanish and Han Chinese populations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22361696 2012 Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.
21378380 2011 C14ORF179 encoding IFT43 is mutated in Sensenbrenner syndrome.
20889716 2010 TULP3 bridges the IFT-A complex and membrane phosphoinositides to promote trafficking of G protein-coupled receptors into primary cilia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19450523 2009 SnapShot: Intraflagellar transport.
More...