Property Summary

NCBI Gene PubMed Count 13
PubMed Score 144.12
PubTator Score 35.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (2)

AA Sequence

MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKA      1 - 70
SKFRRKASEEIEDFRLRPQSLNGSDYGGDIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLM     71 - 140
KYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT      141 - 208
//

Text Mined References (17)

PMID Year Title