Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.68
PubTator Score 6.43

Knowledge Summary

Patent (4,424)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 7.07710887096177E-7
oligodendroglioma 2849 0.0159264261837327

Expression

  Differential Expression (2)

Disease log2 FC p
oligodendroglioma 1.500 0.016
psoriasis -1.100 0.000

Synonym

Accession Q96FT7 Q53SB7 Q6GMS1 Q6PIN9 Q9NQA4 ASIC4
Symbols ACCN4
BNAC4

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
Zebrafish OMA EggNOG

Gene RIF (2)

PMID Text
26667795 Acid-sensing ion channel (ASIC) 4 predominantly localizes to an early endosome-related organelle upon heterologous expression
18662336 Data show that transfected ASIC4 is targeted to the plasma membrane in CHO-K1 cells, where it associates with ASIC1a and downregulates exogenous ASIC1a expression.

AA Sequence

MLSGAAGAARRGGAALAPSLTRSLAGTHAGADSCAGADKGSHKETIEERDKRQQRQQRQRQHQGCGAAGS      1 - 70
GSDSPTSGPHPVPVLFPLALSLEEQPLPPLPLGRAPGLLAREGQGREALASPSSRGQMPIEIVCKIKFAE     71 - 140
EDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLHGLGRACGPGPHGLRRTLWALALLTSLAAFLY    141 - 210
QAAGLARGYLTRPHLVAMDPAAPAPVAGFPAVTLCNINRFRHSALSDADIFHLANLTGLPPKDRDGHRAA    211 - 280
GLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPRSSLPSRAGGMGSG    281 - 350
LEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPW    351 - 420
GNCRAESELREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPDSLGGGPEGPCFCPTPCNLTRYGK    421 - 490
EISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIG    491 - 560
ASILTLLEILDYIYEVSWDRLKRVWRRPKTPLRTSTGGISTLGLQELKEQSPCPSRGRVEGGGVSSLLPN    561 - 630
HHHPHGPPGGLFEDFAC                                                         631 - 647
//

Text Mined References (9)

PMID Year Title
26667795 2015 Acid-sensing ion channel (ASIC) 4 predominantly localizes to an early endosome-related organelle upon heterologous expression.
18662336 2008 Regulation of ASIC activity by ASIC4--new insights into ASIC channel function revealed by a yeast two-hybrid assay.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11571555 2001 Acid-sensing ion channel (ASIC) 4 gene: physical mapping, genomic organisation, and evaluation as a candidate for paroxysmal dystonia.
10852210 2000 A new member of acid-sensing ion channels from pituitary gland.
9847074 1998 Toward a complete human genome sequence.