Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.10
PubTator Score 6.43

Knowledge Summary

Patent (4,424)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 7.1e-07
Astrocytoma, Pilocytic 3081 1.4e-03
oligodendroglioma 2850 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.4e-03
oligodendroglioma 1.500 1.6e-02
psoriasis -1.100 7.1e-07

Gene RIF (2)

AA Sequence

MLSGAAGAARRGGAALAPSLTRSLAGTHAGADSCAGADKGSHKETIEERDKRQQRQQRQRQHQGCGAAGS      1 - 70
GSDSPTSGPHPVPVLFPLALSLEEQPLPPLPLGRAPGLLAREGQGREALASPSSRGQMPIEIVCKIKFAE     71 - 140
EDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLHGLGRACGPGPHGLRRTLWALALLTSLAAFLY    141 - 210
QAAGLARGYLTRPHLVAMDPAAPAPVAGFPAVTLCNINRFRHSALSDADIFHLANLTGLPPKDRDGHRAA    211 - 280
GLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPRSSLPSRAGGMGSG    281 - 350
LEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPW    351 - 420
GNCRAESELREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPDSLGGGPEGPCFCPTPCNLTRYGK    421 - 490
EISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIG    491 - 560
ASILTLLEILDYIYEVSWDRLKRVWRRPKTPLRTSTGGISTLGLQELKEQSPCPSRGRVEGGGVSSLLPN    561 - 630
HHHPHGPPGGLFEDFAC                                                         631 - 647
//

Text Mined References (9)

PMID Year Title