Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.68
PubTator Score 6.43

Knowledge Summary

Patent (4,424)

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
oligodendroglioma 2,849
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
oligodendroglioma 1.500 0.016
psoriasis -1.100 0.000

Synonym

Accession Q96FT7 Q53SB7 Q6GMS1 Q6PIN9 Q9NQA4 ASIC4
Symbols ACCN4
BNAC4

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
26667795 Acid-sensing ion channel (ASIC) 4 predominantly localizes to an early endosome-related organelle upon heterologous expression
18662336 Data show that transfected ASIC4 is targeted to the plasma membrane in CHO-K1 cells, where it associates with ASIC1a and downregulates exogenous ASIC1a expression.

AA Sequence

MLSGAAGAARRGGAALAPSLTRSLAGTHAGADSCAGADKGSHKETIEERDKRQQRQQRQRQHQGCGAAGS      1 - 70
GSDSPTSGPHPVPVLFPLALSLEEQPLPPLPLGRAPGLLAREGQGREALASPSSRGQMPIEIVCKIKFAE     71 - 140
EDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLHGLGRACGPGPHGLRRTLWALALLTSLAAFLY    141 - 210
QAAGLARGYLTRPHLVAMDPAAPAPVAGFPAVTLCNINRFRHSALSDADIFHLANLTGLPPKDRDGHRAA    211 - 280
GLRYPEPDMVDILNRTGHQLADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPRSSLPSRAGGMGSG    281 - 350
LEIMLDIQQEEYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPW    351 - 420
GNCRAESELREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPDSLGGGPEGPCFCPTPCNLTRYGK    421 - 490
EISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIG    491 - 560
ASILTLLEILDYIYEVSWDRLKRVWRRPKTPLRTSTGGISTLGLQELKEQSPCPSRGRVEGGGVSSLLPN    561 - 630
HHHPHGPPGGLFEDFAC                                                         631 - 647
//

Text Mined References (9)

PMID Year Title
26667795 2015 Acid-sensing ion channel (ASIC) 4 predominantly localizes to an early endosome-related organelle upon heterologous expression.
18662336 2008 Regulation of ASIC activity by ASIC4--new insights into ASIC channel function revealed by a yeast two-hybrid assay.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11571555 2001 Acid-sensing ion channel (ASIC) 4 gene: physical mapping, genomic organisation, and evaluation as a candidate for paroxysmal dystonia.
10852210 2000 A new member of acid-sensing ion channels from pituitary gland.
9847074 1998 Toward a complete human genome sequence.