Property Summary

NCBI Gene PubMed Count 36
Grant Count 58
R01 Count 35
Funding $14,417,575.31
PubMed Score 20.57
PubTator Score 48.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma -1.450 0.001

Synonym

Accession Q96FS4 O14518 O60484 O60618 Q2YD83 Sipa-1
Symbols SPA1

Gene

PANTHER Protein Class (2)

Gene RIF (25)

PMID Text
25352027 Our results indicate, for the first time, that the SIPA1 -313A>G may have a prognostic role in unresected NSCLC making it a potential predictor of poor survival due to earlier progression.
24704834 nuclear SIPA1 contributes to breast cancer cell invasion through the regulation of integrin beta1 signaling.
24260471 BRD4 short isoform interacts with RRP1B, SIPA1 and components of the LINC complex at the inner face of the nuclear membrane.
24006220 This meta-analysis suggests that rs746429 is associated with the risk of breast cancer.
23771732 SIPA1 SNPs, rs746429 and rs2306364, were associated with decreased risk of triple-negative breast tumors.
23661532 Polymorphism in Sipa1 promoter gene is associated with lung cancer.
23358895 Patients with metastatic breast cancer with SIPA1 545 T/T genotype had a significantly worse overall survival than did patients with C/T or C/C genotype (50.0% vs. 62.9%, P = 0.042).
22990111 SIPA1 expression is increased in human colorectal cancer.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPMWAGGVGSPRRGMAPASTDDLFARKLRQPARPPLTPHTFEPRPVRGPLLRSGSDAGEARPPTPASPRA      1 - 70
RAHSHEEASRPAATSTRLFTDPLALLGLPAEEPEPAFPPVLEPRWFAHYDVQSLLFDWAPRSQGMGSHSE     71 - 140
ASSGTLASAEDQAASSDLLHGAPGFVCELGGEGELGLGGPASPPVPPALPNAAVSILEEPQNRTSAYSLE    141 - 210
HADLGAGYYRKYFYGKEHQNFFGMDESLGPVAVSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISED    211 - 280
ALPPGPPRGLSPRKLLEHVAPQLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEM    281 - 350
YNNQEAGPAFMQFLTLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQ    351 - 420
QLLRKRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHTPCTPHTTYRVAVSRTQDTPAFGPAL    421 - 490
PAGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLATNEVTTTSLDSASRFGLPSL    491 - 560
GGRRRAAPRGPGAELQAAGSLVWGVRAAPGARVAAGAQASGPEGIEVPCLLGISAEALVLVAPRDGRVVF    561 - 630
NCACRDVLAWTFSEQQLDLYHGRGEAITLRFDGSPGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGF    631 - 700
EVDAEGFVTHVERFTFAETAGLRPGARLLRVCGQTLPSLRPEAAAQLLRSAPKVCVTVLPPDESGRPRRS    701 - 770
FSELYTLSLQEPSRRGAPDPVQDEVQGVTLLPTTKQLLHLCLQDGGSPPGPGDLAEERTEFLHSQNSLSP    771 - 840
RSSLSDEAPVLPNTTPDLLLATTAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLR    841 - 910
NSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSH    911 - 980
LESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA            981 - 1042
//

Text Mined References (43)

PMID Year Title
25352027 2015 The SIPA1 -313A>G polymorphism is associated with prognosis in inoperable non-small cell lung cancer.
24704834 2015 Nuclear SIPA1 activates integrin ?1 promoter and promotes invasion of breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260471 2013 BRD4 short isoform interacts with RRP1B, SIPA1 and components of the LINC complex at the inner face of the nuclear membrane.
24006220 2014 The association of SIPA1 gene polymorphisms with breast cancer risk: evidence from published studies.
23771732 2013 Case-only analyses of the associations between polymorphisms in the metastasis-modifying genes BRMS1 and SIPA1 and breast tumor characteristics, lymph node metastasis, and survival.
23661532 2013 Sipa1 promoter polymorphism predicts risk and metastasis of lung cancer in Chinese.
23358895 2013 Association of SIPA1 545 C > T polymorphism with survival in Chinese women with metastatic breast cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22990111 Expression of signal-induced proliferation-associated gene 1 (SIPA1), a RapGTPase-activating protein, is increased in colorectal cancer and has diverse effects on functions of colorectal cancer cells.
More...