Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96FQ7 A8K9M8
Symbols HsT959
C18orf18

 Compartment GO Term (0)

AA Sequence

MSHSYKKAISDEALRPFQMDYFGGLPPGQYATRMTGQVHGSGCHLRSAPCDLGASQRKLSSNFSEIDAGL      1 - 70
FSQGKSAAYTDIGATKPVEQRETAS                                                  71 - 95
//

Text Mined References (5)

PMID Year Title