Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96FQ7 A8K9M8
Symbols HsT959
C18orf18

Gene

 Compartment GO Term (0)

AA Sequence

MSHSYKKAISDEALRPFQMDYFGGLPPGQYATRMTGQVHGSGCHLRSAPCDLGASQRKLSSNFSEIDAGL      1 - 70
FSQGKSAAYTDIGATKPVEQRETAS                                                  71 - 95
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.