Property Summary

NCBI Gene PubMed Count 20
PubMed Score 2.30
PubTator Score 7.47

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96FQ6 A8K439 D3DV52 Q5RHS6
Symbols AAG13
S100F
DT1P1A7

Gene

PDB

2L50   2L51   3NXA  

 GO Process (1)

Gene RIF (4)

PMID Text
26353754 These results indicate that S100 calcium binding protein A16 is a differentiation promoting protein and might function as a tumor suppressor in oral squamous cell carcinoma.
25884418 Co-expression of S100A14 and S100A16 correlates with a poor prognosis in human breast cancer and promotes cancer cell invasion
25287362 S100A16 had a potential function to regulate some embryonic transcription factors to promote epithelial-mensenchymal transition in breast cancer cells which may be an important target site for the therapy of breast cancer.
21046186 The presence of hydrophobic interactions stronger than for other S100 proteins, present in the closed form of S100A16 between the third and fourth helices, likely make the closed structure of the second EF-hand particularly stable.

AA Sequence

MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANH      1 - 70
DGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS                                          71 - 103
//

Text Mined References (23)

PMID Year Title
26353754 2015 S100A16 promotes differentiation and contributes to a less aggressive tumor phenotype in oral squamous cell carcinoma.
25884418 2015 Co-expression of S100A14 and S100A16 correlates with a poor prognosis in human breast cancer and promotes cancer cell invasion.
25416956 2014 A proteome-scale map of the human interactome network.
25287362 2014 Up-regulation of S100A16 expression promotes epithelial-mesenchymal transition via Notch1 pathway in breast cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
21046186 2011 Structural characterization of human S100A16, a low-affinity calcium binder.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
More...