Property Summary

NCBI Gene PubMed Count 22
PubMed Score 2.30
PubTator Score 7.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma -1.624 8.3e-07
Astrocytoma, Pilocytic 1.400 1.2e-08
atypical teratoid/rhabdoid tumor -1.100 4.8e-04
cystic fibrosis 1.092 6.3e-05
Duchenne muscular dystrophy 1.005 7.7e-09
ductal carcinoma in situ 1.400 1.0e-02
glioblastoma 1.300 4.9e-02
group 3 medulloblastoma -1.400 2.3e-04
lung carcinoma -1.700 3.2e-16
mucosa-associated lymphoid tissue lympho... 1.160 3.1e-02
ovarian cancer 1.200 3.3e-04
pancreatic cancer 1.600 1.7e-07
pituitary cancer -1.200 8.6e-05
posterior fossa group A ependymoma 1.100 2.3e-09
primary pancreatic ductal adenocarcinoma 1.647 1.9e-02
psoriasis 1.100 2.0e-58
subependymal giant cell astrocytoma 1.306 1.1e-02

Gene RIF (5)

AA Sequence

MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANH      1 - 70
DGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS                                          71 - 103
//

Text Mined References (25)

PMID Year Title