Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.53
PubTator Score 0.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 9.77220581036972E-7
atypical teratoid / rhabdoid tumor 4369 8.74980631785201E-6
glioblastoma 5572 0.00101713494835197
medulloblastoma, large-cell 6234 0.00194709574895453
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0119358921554627
Disease Target Count
Mitochondrial Complex 1 Deficiency 28

Expression

  Differential Expression (5)

Synonym

Accession Q96FN9 D3DS87
Symbols C14orf126

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

AA Sequence

MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLS      1 - 70
ETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEAR     71 - 140
VVVEHGTYGNRQVLKLDTNGPFTHLIEF                                              141 - 168
//

Text Mined References (6)

PMID Year Title
22939629 2012 A census of human soluble protein complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.