Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.78
PubTator Score 0.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 8.7e-06
glioblastoma 1.200 1.0e-03
medulloblastoma, large-cell 1.400 1.9e-03
ovarian cancer -1.200 9.8e-07
pancreatic ductal adenocarcinoma liver m... -1.072 1.2e-02

AA Sequence

MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLS      1 - 70
ETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEAR     71 - 140
VVVEHGTYGNRQVLKLDTNGPFTHLIEF                                              141 - 168
//

Text Mined References (6)

PMID Year Title