Property Summary

NCBI Gene PubMed Count 39
Grant Count 15
R01 Count 9
Funding $1,355,597.27
PubMed Score 108.47
PubTator Score 70.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (58)

Disease Z-score Confidence
Acute myeloid leukemia, disease 16
African trypanosomiasis 5
Becker muscular dystrophy 187
Blastic phase chronic myeloid leukemia 58
Chemotherapy-induced nausea and vomiting 18
Chloroquine Resistant Plasmodium Falcipa... 1 
Chloroquine-Resistant Plasmodium Falcipa... 1 
Chronic Myelocytic Leukemia Accelerated ... 59 
Chronic eosinophilic leukemia 11
Chronic hepatitis C 12
Chronic phase chronic myeloid leukemia 45
Dermatofibrosarcoma protuberans 16
Duchenne muscular dystrophy 602
Duodenal ulcer disease 7
Dyspepsia Prevention 2
Encephalitis due to Toxoplasmosis 1
Erosive esophagitis 6
Gastric ulcer 34
Gastroesophageal reflux disease 37
Gastrointestinal stromal tumor 61
Gingivitis 19
Heartburn 3
Heartburn Prevention 2
Human immunodeficiency virus infection 6
Idiopathic hypereosinophilic syndrome 9
Indigestion 5
Kidney Diseases 86
Maintenance of Healing Duodenal Ulcer 7
Malaria 140
Metastatic Prostate Carcinoma 18
Mouth Infection Prevention 5
Myelodysplastic/ Myeloproliferative Dise... 9 
Peptic reflux disease 4
Philadelphia Chromosome Positive Chronic... 45 
Philadelphia chromosome-positive acute l... 47 
Pneumocystis Carinii Pneumonia Preventio... 3 
Pneumocystosis jiroveci pneumonia 7
Prevention of Post-Operative Nausea and ... 14 
Prevention of Radiation-Induced Nausea a... 7 
Relapsing remitting multiple sclerosis 14
Systemic mast cell disease 12
Toxoplasmosis 16
Toxoplasmosis associated with acquired i... 1 
Zollinger-Ellison Syndrome 14
adrenocortical carcinoma 1,427
cutaneous lupus erythematosus 1,056
limb girdle muscular dystrophy 2B 74
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
nephrosclerosis 329
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
pancreatic ductal adenocarcinoma liver m... 1,795 
pituitary cancer 1,972
psoriasis 6,685
subependymal giant cell astrocytoma 2,287

Expression

  Differential Expression (16)

Disease log2 FC p
nephrosclerosis -2.077 0.018
malignant mesothelioma -5.600 0.000
oligodendroglioma -1.100 0.032
psoriasis -1.700 0.000
cutaneous lupus erythematosus -2.400 0.000
osteosarcoma -3.047 0.000
Duchenne muscular dystrophy -1.365 0.000
Becker muscular dystrophy -1.102 0.003
limb girdle muscular dystrophy 2B -1.271 0.000
adrenocortical carcinoma -1.590 0.021
pancreatic ductal adenocarcinoma liver m... -2.281 0.018
non-small cell lung cancer -1.306 0.000
lung cancer -1.500 0.002
subependymal giant cell astrocytoma 2.173 0.013
lung carcinoma -2.200 0.000
pituitary cancer -3.300 0.000

Gene RIF (37)

PMID Text
26784938 MATE1 rs2289669 may be a significant determinant in the renal clearance of metformin in the case of transporter-mediated drug interactions
26538438 MATE1 sequesters organic cations within an intracellular compartment that has no influence on secretion in renal proximal tubules.
26004431 SLC47A1 rs2289669 G>A variants improve the glucose-lowering effect of metformin through slowing its excretion in type 2 diabetes populations.
25862351 MRNA levels of multidrug and toxin extrusion protein 1 (MATE1 or SLC47A1, encoded by 1 of the 11 genes) were significantly lower in patients with FILI.
25753371 Disease progression according to RECIST was also more frequent in carriers of at least one polymorphic MATE1 A-allele (44%) as compared with homozygous carriers of the wild-type G-allele (12.5%) (P=0.07). OCT1 and MATE1 were not associated with PFS.
25241911 MATE1 is a membrane transporter for quercetin.MATE1 was highly expressed in peroxisomes and the endoplasmic reticulum as well as in plasma membranes in the liver and intestine.
23864433 ADMA and L-arginine are substrates of human CAT2A, CAT2B, OCT2 and MATE1. Transport kinetics of CAT2A, CAT2B, and OCT2 indicate a low affinity, high capacity transport, which may be relevant for renal and hepatic elimination of ADMA or L-arginine
23630107 The results confirmed that OAT1, OAT3, OCT2, MATE1, and MATE2-K were coexpressed in tubular epithelial cells.
23303678 Decreasing expression of OCT3 and MATE1 in human placenta indicates these transporters may play a role in fetal protection preferentially at earlier stages of gestation.
23267855 The effect of novel promoter variants in MATE1 ... on the pharmacokinetics and pharmacodynamics of metformin
More...

AA Sequence

MEAPEEPAPVRGGPEATLEVRGSRCLRLSAFREELRALLVLAGPAFLVQLMVFLISFISSVFCGHLGKLE      1 - 70
LDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSALVLLLCCFPCWALFLNTQHI     71 - 140
LLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLH    141 - 210
LGVIGSALANLISQYTLALLLFLYILGKKLHQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVG    211 - 280
SFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAF    281 - 350
SVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVG    351 - 420
LPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHANLKVNNVPRSGNSALPQ    421 - 490
DPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLLLGVFLILLVG    491 - 560
ILVRFYVRIQ                                                                561 - 570
//

Text Mined References (43)

PMID Year Title
26784938 2016 The MATE1 rs2289669 polymorphism affects the renal clearance of metformin following ranitidine treatment.
26538438 2016 The multidrug transporter MATE1 sequesters OCs within an intracellular compartment that has no influence on OC secretion in renal proximal tubules.
26004431 2015 SLC47A1 gene rs2289669 G>A variants enhance the glucose-lowering effect of metformin via delaying its excretion in Chinese type 2 diabetes patients.
25862351 2015 Association of decreased mRNA expression of multidrug and toxin extrusion protein 1 in peripheral blood cells with the development of flutamide-induced liver injury.
25753371 2015 Multidrug and toxin extrusion 1 and human organic cation transporter 1 polymorphisms in patients with castration-resistant prostate cancer receiving metformin (SAKK 08/09).
25241911 2014 Multidrug and toxic compound extrusion protein-1 (MATE1/SLC47A1) is a novel flavonoid transporter.
23864433 2013 Transport of asymmetric dimethylarginine (ADMA) by cationic amino acid transporter 2 (CAT2), organic cation transporter 2 (OCT2) and multidrug and toxin extrusion protein 1 (MATE1).
23630107 2013 Precise comparison of protein localization among OCT, OAT, and MATE in human kidney.
23303678 2013 Organic cation transporter 3 (OCT3/SLC22A3) and multidrug and toxin extrusion 1 (MATE1/SLC47A1) transporter in the placenta and fetal tissues: expression profile and fetus protective role at different stages of gestation.
23267855 2013 The effect of novel promoter variants in MATE1 and MATE2 on the pharmacokinetics and pharmacodynamics of metformin.
More...