Property Summary

Ligand Count 19
NCBI Gene PubMed Count 48
PubMed Score 126.59
PubTator Score 70.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Kidney Diseases 114 0.0 0.0
Disease Target Count
Acute myeloid leukemia, disease 30
African trypanosomiasis 5
Blastic phase chronic myeloid leukemia 58
Chemotherapy-induced nausea and vomiting 18
Chloroquine Resistant Plasmodium Falciparum Malaria 1
Chloroquine-Resistant Plasmodium Falciparum Malaria Prevention 1
Chronic Myelocytic Leukemia Accelerated Phase 59
Chronic eosinophilic leukemia 11
Chronic hepatitis C 12
Chronic phase chronic myeloid leukemia 45
Dermatofibrosarcoma protuberans 15
Duodenal ulcer disease 7
Dyspepsia Prevention 2
Encephalitis due to Toxoplasmosis 1
Erosive esophagitis 6
Gastric ulcer 33
Gastroesophageal reflux disease 110
Gastrointestinal stromal tumor 62
Gingivitis 29
Heartburn 78
Heartburn Prevention 2
Human immunodeficiency virus infection 6
Idiopathic hypereosinophilic syndrome 10
Indigestion 4
Maintenance of Healing Duodenal Ulcer 7
Malaria 160
Metastatic Prostate Carcinoma 18
Mouth Infection Prevention 5
Myelodysplastic/ Myeloproliferative Diseases associated with Platelet-derived Growth Factor Receptor 9
Peptic reflux disease 4
Philadelphia Chromosome Positive Chronic Myelocytic Leukemia 45
Philadelphia chromosome-positive acute lymphoblastic leukemia 47
Pneumocystis Carinii Pneumonia Prevention 3
Pneumocystosis jiroveci pneumonia 7
Prevention of Post-Operative Nausea and Vomiting 14
Prevention of Radiation-Induced Nausea and Vomiting 7
Relapsing remitting multiple sclerosis 14
Systemic mast cell disease 12
Toxoplasmosis 17
Toxoplasmosis associated with acquired immunodeficiency syndrome 1
Zollinger-Ellison syndrome 18
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma -1.590 2.1e-02
Becker muscular dystrophy -1.102 3.3e-03
cutaneous lupus erythematosus -2.400 3.6e-05
Duchenne muscular dystrophy -1.365 3.1e-07
limb girdle muscular dystrophy 2B -1.271 7.2e-05
lung cancer -1.500 1.7e-03
lung carcinoma -2.200 4.2e-15
malignant mesothelioma -5.600 3.5e-10
nephrosclerosis -2.077 1.8e-02
non-small cell lung cancer -1.306 9.7e-07
oligodendroglioma -1.100 3.2e-02
osteosarcoma -3.047 9.1e-07
pancreatic ductal adenocarcinoma liver m... -2.281 1.8e-02
pituitary cancer -3.300 1.8e-05
psoriasis -1.400 6.1e-09
subependymal giant cell astrocytoma 2.173 1.3e-02

Protein-protein Interaction (1)

Gene RIF (46)

AA Sequence

MEAPEEPAPVRGGPEATLEVRGSRCLRLSAFREELRALLVLAGPAFLVQLMVFLISFISSVFCGHLGKLE      1 - 70
LDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSALVLLLCCFPCWALFLNTQHI     71 - 140
LLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLH    141 - 210
LGVIGSALANLISQYTLALLLFLYILGKKLHQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVG    211 - 280
SFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAF    281 - 350
SVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVG    351 - 420
LPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHANLKVNNVPRSGNSALPQ    421 - 490
DPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLLLGVFLILLVG    491 - 560
ILVRFYVRIQ                                                                561 - 570
//

Text Mined References (52)

PMID Year Title