Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.8e-04
group 3 medulloblastoma 4104 1.8e-03

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.8e-03
osteosarcoma -1.550 4.8e-04

AA Sequence

MEKIEEQFANLHIVKCSLGTKEPTYLLGIDTSKTVQAGKENLVAVLCSNGSIRIYDKERLNVLREFSGYP      1 - 70
GLLNGVRFANSCDSVYSACTDGTVKCWDARVAREKPVQLFKGYPSNIFISFDINCNDHIICAGTEKVDDD     71 - 140
ALLVFWDARMNSQNLSTTKDSLGAYSETHSDDVTQVRFHPSNPNMVVSGSSDGLVNVFDINIDNEEDALV    141 - 210
TTCNSISSVSCIGWSGKGYKQIYCMTHDEGFYWWDLNHLDTDEPVTRLNIQDVREVVNMKEDALDYLIGG    211 - 280
LYHEKTDTLHVIGGTNKGRIHLMNCSMSGLTHVTSLQGGHAATVRSFCWNVQDDSLLTGGEDAQLLLWKP    281 - 350
GAIEKTFTKKESMKIASSVHQRVRVHSNDSYKRRKKQ                                     351 - 387
//

Text Mined References (8)

PMID Year Title