Property Summary

NCBI Gene PubMed Count 23
PubMed Score 4.53
PubTator Score 8.41

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET      1 - 70
KHFIYFYLGQVAILLFKSG                                                        71 - 89
//

Text Mined References (27)

PMID Year Title