Property Summary

NCBI Gene PubMed Count 20
PubMed Score 3.98
PubTator Score 8.41

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96FJ2 B2R5B4
Symbols Dlc2
DNCL1B
RSPH22

Gene

PDB

4D07   2XQQ   3P8M  

 GO Function (1)

Gene RIF (2)

PMID Text
25312846 The DYNLL2 binding region, located in an intrinsically disordered domain of the myo5a tail, has a nascent helical character.
20889982 the thermodynamic and kinetic fine-tuning of binding of various ligands to DYNLL could have physiological relevance in its interaction network.

AA Sequence

MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET      1 - 70
KHFIYFYLGQVAILLFKSG                                                        71 - 89
//

Text Mined References (24)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25312846 2014 DYNLL2 dynein light chain binds to an extended linear motif of myosin 5a tail that has structural plasticity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20889982 2010 Affinity, avidity, and kinetics of target sequence binding to LC8 dynein light chain isoforms.
More...