Property Summary

NCBI Gene PubMed Count 65
Grant Count 95
R01 Count 38
Funding $10,806,881.2
PubMed Score 101.09
PubTator Score 107.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.185 0.001
medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.700 0.000
pediatric high grade glioma -1.300 0.000
Breast cancer -1.800 0.000
gastric carcinoma -1.100 0.009

Synonym

Accession Q96FI4 D3DW75 Q6ZRA7 Q86XW7 Q9H6C3
Symbols FPG1
NEI1
hFPG1

Gene

PDB

1TDH   4NRV   5ITQ   5ITR   5ITT   5ITU   5ITX   5ITY  

Gene RIF (59)

PMID Text
26751644 NEIL1 and NEIL2 cooperate with TDG during base excision: TDG occupies the abasic site and is displaced by NEILs, which further process the baseless sugar, thereby stimulating TDG-substrate turnover.
26134572 NEIL1 forms a multiprotein complex with DNA replication proteins via its C-terminal domain, allowing recruitment at the replication fork.
26095805 Findings suggesting that DNA glycosylase NEIL1 c.C844T is a defective allele.
26074017 first study to show that SNPs of genes involved in DNA repair, may modulate the risk of Depressive Disorder.
25873625 Rad9 regulates base excision repair by controlling NEIL1 transcription.
25605055 Results show that YB-1 interferes negatively with the AP site DNA cleavage activity of both APE1 and NEIL1 for ssDNA and bubble structures.
24382305 genome and cancer single nucleotide polymorphisms of the human NEIL1 DNA glycosylase
24022861 The NEIL1 rs4462560 SNP may serve as a predictor of acute RIET and RP risk but not of overall survival.
23926102 one role for Neil3 and NEIL1 is to repair DNA base damages in telomeres in vivo and that Neil3 and Neil1 may function in quadruplex-mediated cellular events, such as gene regulation via removal of damaged bases from quadruplex DNA.
23898192 Prereplicative repair of oxidized bases in the human genome is mediated by NEIL1 DNA glycosylase together with replication proteins.
More...

AA Sequence

MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQ      1 - 70
EPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQE     71 - 140
YQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEALQQHRPSPEL    141 - 210
TLSQKIRTKLQNPDLLELCHSVPKEVVQLGGKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIW    211 - 280
FQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPE    281 - 350
APTVPKKGRRKGRQAASGHCRPRKVKADIPSLEPEGTSAS                                  351 - 390
//

Text Mined References (66)

PMID Year Title
26751644 2016 Neil DNA glycosylases promote substrate turnover by Tdg during DNA demethylation.
26134572 2015 The C-terminal Domain (CTD) of Human DNA Glycosylase NEIL1 Is Required for Forming BERosome Repair Complex with DNA Replication Proteins at the Replicating Genome: DOMINANT NEGATIVE FUNCTION OF THE CTD.
26095805 2015 NEIL1 p.Gln282Stop variant is predominantly localized in the cytoplasm and exhibits reduced activity in suppressing mutations.
26074017 2015 Association between single nucleotide polymorphisms of MUTYH, hOGG1 and NEIL1 genes, and depression.
25873625 2015 Regulation of NEIL1 protein abundance by RAD9 is important for efficient base excision repair.
25605055 2015 Inhibition of abasic site cleavage in bubble DNA by multifunctional protein YB-1.
24382305 2014 Genome and cancer single nucleotide polymorphisms of the human NEIL1 DNA glycosylase: activity, structure, and the effect of editing.
24022861 2013 A NEIL1 single nucleotide polymorphism (rs4462560) predicts the risk of radiation-induced toxicities in esophageal cancer patients treated with definitive radiotherapy.
23926102 2013 Neil3 and NEIL1 DNA glycosylases remove oxidative damages from quadruplex DNA and exhibit preferences for lesions in the telomeric sequence context.
23898192 2013 Prereplicative repair of oxidized bases in the human genome is mediated by NEIL1 DNA glycosylase together with replication proteins.
More...