Property Summary

NCBI Gene PubMed Count 71
PubMed Score 106.07
PubTator Score 107.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 5.2e-06
Breast cancer -1.800 1.1e-05
gastric carcinoma -1.100 9.1e-03
glioblastoma -1.400 5.8e-07
group 3 medulloblastoma -1.500 2.8e-03
medulloblastoma, large-cell -1.700 5.2e-05
osteosarcoma -1.185 9.1e-04
pediatric high grade glioma -1.300 6.5e-07
psoriasis -1.600 3.6e-04

Protein-protein Interaction (1)

Gene RIF (65)

AA Sequence

MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQ      1 - 70
EPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQE     71 - 140
YQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEALQQHRPSPEL    141 - 210
TLSQKIRTKLQNPDLLELCHSVPKEVVQLGGKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIW    211 - 280
FQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPE    281 - 350
APTVPKKGRRKGRQAASGHCRPRKVKADIPSLEPEGTSAS                                  351 - 390
//

Text Mined References (72)

PMID Year Title