Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.55
PubTator Score 0.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.500 7.9e-05
astrocytic glioma -1.100 8.2e-03
Astrocytoma, Pilocytic 1.100 4.2e-05
atypical teratoid / rhabdoid tumor -1.600 3.1e-09
ependymoma 1.400 8.3e-10
glioblastoma -1.100 3.1e-07
malignant mesothelioma -1.200 5.9e-05
osteosarcoma -3.018 8.6e-08
ovarian cancer 1.600 4.1e-05
subependymal giant cell astrocytoma 1.733 2.9e-03

Gene RIF (3)

AA Sequence

MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYA      1 - 70
CSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHSPEEPPPPSSA                          71 - 119
//

Text Mined References (14)

PMID Year Title