Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.87
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
DEAFNESS, AUTOSOMAL RECESSIVE 88 1 0.0 0.0
Disease Target Count P-value
ductal carcinoma in situ 1745 1.4e-03
invasive ductal carcinoma 2951 6.6e-03
breast carcinoma 1638 8.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 3.18 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma -1.100 8.5e-03
ductal carcinoma in situ -1.800 1.4e-03
invasive ductal carcinoma -2.000 6.6e-03

Gene RIF (2)

AA Sequence

MNEKSCSFHSKEELRDGQGERLSAGYSPSYDKDKSVLAFRGIPISELKNHGILQALTTEAYEWEPRVVST      1 - 70
EVVRAQEEWEAVDTIQPETGSQASSEQPGQLISFSEALQHFQTVDLSPFKKRIQPTIRRTGLAALRHYLF     71 - 140
GPPKLHQRLREERDLVLTIAQCGLDSQDPVHGRVLQTIYKKLTGSKFDCALHGNHWEDLGFQGANPATDL    141 - 210
RGAGFLALLHLLYLVMDSKTLPMAQEIFRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKV    211 - 280
IPVVNSFYAATFLHLAHVWRTQRKTISDSGFVLKELEVLAKKSPRRLLKTLELYLARVSKGQASLLGAQK    281 - 350
CYGPEAPPFKDLTFTGESDLQSHSSEGVWLI                                           351 - 381
//

Text Mined References (13)

PMID Year Title