Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.89
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma -1.100 0.008
ductal carcinoma in situ -1.800 0.001
invasive ductal carcinoma -2.000 0.007

Synonym

Accession Q96FG2 B8ZZD6 D6W5K4 Q2M1K3 Q2XSU3 Q2XSU4 Q8NAC1 Q8TCK4 Q8WV70 Q8WY75 Q9H6Q8
Symbols LST3
RBED1
RBM29
DFNB88

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
24616099 The non-opioid sigma-1 receptor (S1R) was identified as a novel effector of GAP activity of ELMOD1-3 proteins as its direct binding to either ELMOD1 or ELMOD2 resulted in loss of GAP activity.
24039609 Collectively, our data provide the first insights into the expression and biochemical properties of ELMOD3 and highlight its functional links to sound perception and actin cytoskeleton.

AA Sequence

MNEKSCSFHSKEELRDGQGERLSAGYSPSYDKDKSVLAFRGIPISELKNHGILQALTTEAYEWEPRVVST      1 - 70
EVVRAQEEWEAVDTIQPETGSQASSEQPGQLISFSEALQHFQTVDLSPFKKRIQPTIRRTGLAALRHYLF     71 - 140
GPPKLHQRLREERDLVLTIAQCGLDSQDPVHGRVLQTIYKKLTGSKFDCALHGNHWEDLGFQGANPATDL    141 - 210
RGAGFLALLHLLYLVMDSKTLPMAQEIFRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKV    211 - 280
IPVVNSFYAATFLHLAHVWRTQRKTISDSGFVLKELEVLAKKSPRRLLKTLELYLARVSKGQASLLGAQK    281 - 350
CYGPEAPPFKDLTFTGESDLQSHSSEGVWLI                                           351 - 381
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24616099 2014 Characterization of recombinant ELMOD (cell engulfment and motility domain) proteins as GTPase-activating proteins (GAPs) for ARF family GTPases.
24039609 2013 An alteration in ELMOD3, an Arl2 GTPase-activating protein, is associated with hearing impairment in humans.
23014990 2012 ELMO domains, evolutionary and functional characterization of a novel GTPase-activating protein (GAP) domain for Arf protein family GTPases.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17452337 2007 ELMOD2 is an Arl2 GTPase-activating protein that also acts on Arfs.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
More...