Property Summary

NCBI Gene PubMed Count 29
PubMed Score 28.75
PubTator Score 18.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.812 5.8e-04
adult high grade glioma 1.200 7.1e-03
Atopic dermatitis 1.100 1.2e-04
atypical teratoid / rhabdoid tumor 1.400 1.5e-06
Breast cancer 1.600 2.2e-10
breast carcinoma 1.400 8.7e-05
ductal carcinoma in situ 1.400 1.9e-03
glioblastoma 1.600 2.5e-07
group 3 medulloblastoma 2.400 8.5e-05
intraductal papillary-mucinous neoplasm ... 1.500 2.0e-03
invasive ductal carcinoma 1.900 2.0e-04
lung adenocarcinoma 2.400 5.6e-10
medulloblastoma, large-cell 2.100 2.8e-05
non-small cell lung cancer 2.559 2.0e-29
osteosarcoma -1.465 1.4e-02
ovarian cancer 1.900 8.2e-09
pancreatic ductal adenocarcinoma liver m... 1.012 3.8e-02
primitive neuroectodermal tumor 1.500 2.0e-03
psoriasis 1.100 2.9e-38

 GO Function (1)

Protein-protein Interaction (5)

Gene RIF (14)

AA Sequence

MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEV      1 - 70
PAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSK     71 - 140
KVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISP    141 - 210
PPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE                                211 - 252
//

Text Mined References (36)

PMID Year Title