Property Summary

NCBI Gene PubMed Count 25
Grant Count 2
Funding $132,739
PubMed Score 25.26
PubTator Score 18.61

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96FF9 A8K625
Symbols SORORIN

Gene

 Grant Application (2)

 GO Function (1)

Gene RIF (12)

PMID Text
26177583 phosphorylation plays unexpected roles in regulating the subcellular localization of Sororin.
25608232 the C-terminus of Sororin functions as an anchor binding to SA2, which facilitates other conserved motifs on Sororin to interact with other proteins to regulate sister chromatid cohesion and separation.
25257309 A transcriptome-wide analysis revealed that SNW1 or PRPF8 depletion affects the splicing of specific introns in a subset of pre-mRNAs, including pre-mRNAs encoding the cohesion protein sororin and the APC/C subunit APC2.
25092791 We propose that the Prp19 complex and the splicing machinery contribute to the establishment of cohesion by promoting Sororin accumulation during S phase, and are, therefore, essential to the maintenance of genome stability.
24098701 Targeting p35/Cdk5 signalling via CIP-peptide promotes angiogenesis in hypoxia.
22833568 Data show that the MEK-ERK pathway regulates cell cycle-related neuronal apoptosis (CRNA) by elevating the levels of cyclin D1, and the increase in cyclin D1 attenuates the activation of cyclin-dependent kinase 5 (cdk5) by its neuronal activator p35.
21987589 Sororin is phosphorylated by Cdk1/cyclin B at prophase and acts as a docking protein to bring Plk1 into proximity with SA2, resulting in the phosphorylation of SA2 and the removal of cohesin complexes from chromosomal arms.
21115494 the interaction of the highly conserved motif at the C terminus of sororin with the cohesin complex is critical to its ability to mediate sister chromatid cohesion.
20551060 Transactivation of CDCA5 and its phosphorylation at Ser209 by ERK play an important role in lung cancer proliferation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEV      1 - 70
PAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSK     71 - 140
KVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISP    141 - 210
PPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE                                211 - 252
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26177583 2016 Multiple Levels of Regulation of Sororin by Cdk1 and Aurora B.
25608232 2015 C-terminus of Sororin interacts with SA2 and regulates sister chromatid cohesion.
25257309 2014 SNW1 enables sister chromatid cohesion by mediating the splicing of sororin and APC2 pre-mRNAs.
25092791 2014 Sororin pre-mRNA splicing is required for proper sister chromatid cohesion in human cells.
24098701 2013 Targeting p35/Cdk5 signalling via CIP-peptide promotes angiogenesis in hypoxia.
23548868 2013 ASURA (PHB2) interacts with Scc1 through chromatin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22833568 2012 Interplay between MEK-ERK signaling, cyclin D1, and cyclin-dependent kinase 5 regulates cell cycle reentry and apoptosis of neurons.
21987589 2011 Interaction of Sororin protein with polo-like kinase 1 mediates resolution of chromosomal arm cohesion.
More...