Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 3 medulloblastoma 4104 3.4e-05
facioscapulohumeral dystrophy 288 3.6e-02

Expression

  Differential Expression (2)

Disease log2 FC p
facioscapulohumeral dystrophy 1.300 3.6e-02
group 3 medulloblastoma -1.700 3.4e-05

AA Sequence

METPIEREIRRSCEREESLRRSRGLSPGRAGRELVELRVRPVLNLPGPGPALPRALERARAGAQMQRDIE      1 - 70
REAHRQAALARPAVPEPRARSPPQPLGELKRFFEAAAGSGSSAGAGDGAGPQRLPEPGGRPRSAVQGGCR     71 - 140
VLGSAPPPFTPSLLEQEVRAVREREQELQRQRRSVYGTAEFKEPTPSLTASRGDGKLVVIWPPRRKVSEN    141 - 210
GLEQEERKP                                                                 211 - 219
//

Text Mined References (4)

PMID Year Title