Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.30
PubTator Score 9.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.100 2.8e-05
group 3 medulloblastoma -1.300 8.8e-04
lung adenocarcinoma -1.400 7.2e-09
lung cancer -2.400 1.6e-05
malignant mesothelioma -3.400 1.0e-07
medulloblastoma, large-cell -1.500 4.2e-05
non diabetic and post-ischemic heart fai... 1.200 4.7e-03
osteosarcoma 1.015 2.2e-02
ovarian cancer -1.300 1.4e-05

Gene RIF (4)

AA Sequence

MLLAWVQAFLVSNMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASAPVSGAGNHSYC      1 - 70
RNPDEDPRGPWCYVSGEAGVPEKRPCEDLRCPETTSQALPAFTTEIQEASEGPGADEVQVFAPANALPAR     71 - 140
SEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVIIIAIGAGIILGYSYKRGKDLKEQHDQKVCE    141 - 210
REMQRITLPLSAFTNPTCEIVDEKTVVVHTSQTPVDPQEGTTPLMGQAGTPGA                     211 - 263
//

Text Mined References (16)

PMID Year Title