Tbio | Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 |
Functional component of the Nogo receptor signaling complex (RTN4R/NGFR) in RhoA activation responsible for some inhibition of axonal regeneration by myelin-associated factors (PubMed:14966521, PubMed:15694321). Is also an important negative regulator of oligodentrocyte differentiation and axonal myelination (PubMed:15895088). Acts in conjunction with RTN4 and RTN4R in regulating neuronal precursor cell motility during cortical development (By similarity).
Comments
Disease | Target Count |
---|---|
Essential tremor | 30 |
Disease | Target Count | P-value |
---|---|---|
astrocytoma | 1493 | 1.53799717258842E-9 |
medulloblastoma | 1524 | 4.63347142578328E-8 |
atypical teratoid / rhabdoid tumor | 4369 | 1.59798558373172E-7 |
ependymoma | 2514 | 4.26596860977443E-4 |
pediatric high grade glioma | 2712 | 0.00253989907610336 |
glioblastoma | 5572 | 0.00296859351893673 |
medulloblastoma, large-cell | 6234 | 0.00522270256042271 |
invasive ductal carcinoma | 2950 | 0.0126082745145452 |
inflammatory breast cancer | 404 | 0.0373938765524165 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Movement disease | 10 | 0.0 | 2.0 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Multiple Sclerosis | 498 | 4.29 | 2.1 |
Parkinson's disease | 364 | 3.47 | 1.7 |
Optic neuritis | 9 | 3.106 | 1.6 |
Disease | log2 FC | p |
---|---|---|
astrocytoma | -1.200 | 0.000 |
glioblastoma | -2.500 | 0.003 |
ependymoma | -1.400 | 0.000 |
medulloblastoma | -2.500 | 0.000 |
atypical teratoid / rhabdoid tumor | -2.600 | 0.000 |
medulloblastoma, large-cell | -2.300 | 0.005 |
pediatric high grade glioma | -1.900 | 0.003 |
inflammatory breast cancer | 1.100 | 0.037 |
invasive ductal carcinoma | 1.200 | 0.013 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA Inparanoid |
PMID | Text |
---|---|
26979953 | LINGO1 protein acts as a gateway protein internalizing into the tumor cells when engaged by antibody and can carry antibody conjugated with drugs to kill Ewing sarcoma cells. |
26254004 | LINGO1 rs11856808 plays a protective role by decreasing the risk for PD, but not for MSA, in Chinese population. |
25666623 | Data indicate that leucine-rich repeat neuronal protein 1 (LINGO-1) is intracellular and competes with Nogo-66 receptor (NgR) for binding to p75 neurotrophin receptor (p75NTR). |
24583087 | LINGO-1 can directly bind to ErbB2, block ErbB2 translocation into lipid rafts, and inhibit its phosphorylation. |
24531928 | The results of this study show Increased LINGO1 in the cerebellum of essential tremor patients. |
24448210 | Lingo-1 signaling is altered in the schizophrenia brain. |
23754655 | LINGO1 variants are associated with essential tremor in Chinese Han female patients. |
23682623 | This review found that several gene variants in the LINGO1 gene may increase the risk of essential tremor. |
23574883 | This study demonistrated that theLINGO1 rs9652490 and rs11856808 polymorphisms are not associated with risk for multiple sclerosis. |
23482566 | LINGO-1 potentiates neuronal apoptosis, likely by inhibiting WNK3 kinase activity. |
More... |
MQVSKRMLAGGVRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRKRFVAVPEGIP 1 - 70 TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFT 71 - 140 GLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEA 141 - 210 LSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPY 211 - 280 LAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTL 281 - 350 EESVFHSVGNLETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFT 351 - 420 CRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDGTLEVRYAQVQ 421 - 490 DNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATVPFPFDIKTLIIA 491 - 560 TTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRKSDAGISSADAPRKFNMKMI 561 - 620 //
PMID | Year | Title |
---|---|---|
26979953 | 2016 | Exploring the surfaceome of Ewing sarcoma identifies a new and unique therapeutic target. |
26254004 | 2015 | Analysis and meta-analysis of five polymorphisms of the LINGO1 and LINGO2 genes in Parkinson's disease and multiple system atrophy in a Chinese population. |
25666623 | 2015 | LINGO-1 protein interacts with the p75 neurotrophin receptor in intracellular membrane compartments. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
24583087 | 2014 | LINGO-1 regulates oligodendrocyte differentiation by inhibiting ErbB2 translocation and activation in lipid rafts. |
24531928 | 2014 | Increased LINGO1 in the cerebellum of essential tremor patients. |
24448210 | 2014 | Novel implications of Lingo-1 and its signaling partners in schizophrenia. |
23754655 | 2013 | Genetic analysis of the leucine-rich repeat and lg domain containing Nogo receptor-interacting protein 1 gene in essential tremor. |
23682623 | 2013 | Update on genetics of essential tremor. |
23574883 | 2013 | LINGO1 rs9652490 and rs11856808 polymorphisms are not associated with risk for multiple sclerosis. |
More... |