Property Summary

NCBI Gene PubMed Count 48
Grant Count 17
R01 Count 13
Funding $1,312,300.1
PubMed Score 94.32
PubTator Score 93.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma -1.200 0.000
glioblastoma -2.500 0.003
ependymoma -1.400 0.000
medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -2.300 0.005
pediatric high grade glioma -1.900 0.003
inflammatory breast cancer 1.100 0.037
invasive ductal carcinoma 1.200 0.013

Gene RIF (50)

PMID Text
26979953 LINGO1 protein acts as a gateway protein internalizing into the tumor cells when engaged by antibody and can carry antibody conjugated with drugs to kill Ewing sarcoma cells.
26254004 LINGO1 rs11856808 plays a protective role by decreasing the risk for PD, but not for MSA, in Chinese population.
25666623 Data indicate that leucine-rich repeat neuronal protein 1 (LINGO-1) is intracellular and competes with Nogo-66 receptor (NgR) for binding to p75 neurotrophin receptor (p75NTR).
24583087 LINGO-1 can directly bind to ErbB2, block ErbB2 translocation into lipid rafts, and inhibit its phosphorylation.
24531928 The results of this study show Increased LINGO1 in the cerebellum of essential tremor patients.
24448210 Lingo-1 signaling is altered in the schizophrenia brain.
23754655 LINGO1 variants are associated with essential tremor in Chinese Han female patients.
23682623 This review found that several gene variants in the LINGO1 gene may increase the risk of essential tremor.
23574883 This study demonistrated that theLINGO1 rs9652490 and rs11856808 polymorphisms are not associated with risk for multiple sclerosis.
23482566 LINGO-1 potentiates neuronal apoptosis, likely by inhibiting WNK3 kinase activity.
More...

AA Sequence

MQVSKRMLAGGVRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRKRFVAVPEGIP      1 - 70
TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFT     71 - 140
GLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEA    141 - 210
LSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPY    211 - 280
LAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTL    281 - 350
EESVFHSVGNLETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFT    351 - 420
CRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDGTLEVRYAQVQ    421 - 490
DNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATVPFPFDIKTLIIA    491 - 560
TTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRKSDAGISSADAPRKFNMKMI              561 - 620
//

Text Mined References (52)

PMID Year Title
26979953 2016 Exploring the surfaceome of Ewing sarcoma identifies a new and unique therapeutic target.
26254004 2015 Analysis and meta-analysis of five polymorphisms of the LINGO1 and LINGO2 genes in Parkinson's disease and multiple system atrophy in a Chinese population.
25666623 2015 LINGO-1 protein interacts with the p75 neurotrophin receptor in intracellular membrane compartments.
25416956 2014 A proteome-scale map of the human interactome network.
24583087 2014 LINGO-1 regulates oligodendrocyte differentiation by inhibiting ErbB2 translocation and activation in lipid rafts.
24531928 2014 Increased LINGO1 in the cerebellum of essential tremor patients.
24448210 2014 Novel implications of Lingo-1 and its signaling partners in schizophrenia.
23754655 2013 Genetic analysis of the leucine-rich repeat and lg domain containing Nogo receptor-interacting protein 1 gene in essential tremor.
23682623 2013 Update on genetics of essential tremor.
23574883 2013 LINGO1 rs9652490 and rs11856808 polymorphisms are not associated with risk for multiple sclerosis.
More...