Property Summary

NCBI Gene PubMed Count 48
PubMed Score 101.96
PubTator Score 93.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.600 2.7e-03
astrocytoma -1.200 1.5e-09
atypical teratoid / rhabdoid tumor -2.600 1.6e-07
ependymoma -1.400 4.3e-04
glioblastoma -1.300 7.6e-03
group 4 medulloblastoma -2.200 1.1e-05
inflammatory breast cancer 1.100 3.7e-02
invasive ductal carcinoma 1.200 1.3e-02
medulloblastoma, large-cell -2.300 5.2e-03

 MGI Phenotype (1)

Protein-protein Interaction (7)

Gene RIF (50)

AA Sequence

MQVSKRMLAGGVRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRKRFVAVPEGIP      1 - 70
TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFT     71 - 140
GLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEA    141 - 210
LSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPY    211 - 280
LAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTL    281 - 350
EESVFHSVGNLETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFT    351 - 420
CRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDGTLEVRYAQVQ    421 - 490
DNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATVPFPFDIKTLIIA    491 - 560
TTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRKSDAGISSADAPRKFNMKMI              561 - 620
//

Text Mined References (53)

PMID Year Title