Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.53
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 2.4e-05
aldosterone-producing adenoma -1.112 2.7e-02
atypical teratoid / rhabdoid tumor -3.100 2.1e-06
glioblastoma -1.300 3.3e-04
intraductal papillary-mucinous adenoma (... -1.700 3.5e-04
intraductal papillary-mucinous carcinoma... -1.600 6.9e-04
intraductal papillary-mucinous neoplasm ... -1.700 6.0e-03
lung carcinoma 2.800 5.2e-16
medulloblastoma -1.300 3.1e-06
ovarian cancer 1.200 6.0e-04
spina bifida -1.419 3.3e-02

Gene RIF (3)

AA Sequence

MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDGNKSQDSGIAEMEELPVPHNIKISNITCDSFKISW      1 - 70
EMDSKSKDRITHYFIDLNKKENKNSNKFKHKDVPTKLVAKAVPLPMTVRGHWFLSPRTEYTVAVQTASKQ     71 - 140
VDGDYVVSEWSEIIEFCTADYSKVHLTQLLEKAEVIAGRMLKFSVFYRNQHKEYFDYVREHHGNAMQPSV    141 - 210
KDNSGSHGSPISGKLEGIFFSCSTEFNTGKPPQDSPYGRYRFEIAAEKLFNPNTNLYFGDFYCMYTAYHY    211 - 280
VILVIAPVGSPGDEFCKQRLPQLNSKDNKFLTCTEEDGVLVYHHAQDVILEVIYTDPVDLSVGTVAEITG    281 - 350
HQLMSLSTANAKKDPSCKTCNISVGR                                                351 - 376
//

Text Mined References (20)

PMID Year Title