Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.17
PubTator Score 0.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.143 3.5e-02
aldosterone-producing adenoma -1.737 1.2e-02
Atopic dermatitis 1.300 1.9e-03
group 3 medulloblastoma 2.200 9.4e-06
osteosarcoma -1.390 6.4e-04
ovarian cancer 1.600 4.3e-03
pancreatic ductal adenocarcinoma liver m... -1.532 1.7e-03

AA Sequence

MVVREASAAQASLSQVLPQLRYLHIFLEQVHTHFQEQSVGERGAAIQLAEGLARQLCTDCQLNKLFYREE      1 - 70
FVLATLLDPCFKGKIEAILPWGPTDIDHWKQVLVYKVKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSS     71 - 140
GVEGRSQGEPLQSSSHSGAFLLAQREKGLLESMGLLASERSGGSLSTKSHWASIIVKKYLWENETVGAQD    141 - 210
DPLAYWEKKREAWPPSICLTPHRSLL                                                211 - 236
//

Text Mined References (6)

PMID Year Title