Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.17
PubTator Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 3 medulloblastoma 2254 9.37331332826153E-6
osteosarcoma 7933 6.35886200463067E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00166440223862552
Atopic dermatitis 944 0.00191264594786104
ovarian cancer 8492 0.00425019752185049
aldosterone-producing adenoma 664 0.012476078674823
adrenocortical carcinoma 1427 0.034570093127209

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.390 0.001
Atopic dermatitis 1.300 0.002
adrenocortical carcinoma -1.143 0.035
pancreatic ductal adenocarcinoma liver m... -1.532 0.002
group 3 medulloblastoma 2.200 0.000
aldosterone-producing adenoma -1.737 0.012
ovarian cancer 1.600 0.004

Synonym

Accession Q96FA7
Symbols C7orf29

Gene

AA Sequence

MVVREASAAQASLSQVLPQLRYLHIFLEQVHTHFQEQSVGERGAAIQLAEGLARQLCTDCQLNKLFYREE      1 - 70
FVLATLLDPCFKGKIEAILPWGPTDIDHWKQVLVYKVKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSS     71 - 140
GVEGRSQGEPLQSSSHSGAFLLAQREKGLLESMGLLASERSGGSLSTKSHWASIIVKKYLWENETVGAQD    141 - 210
DPLAYWEKKREAWPPSICLTPHRSLL                                                211 - 236
//

Text Mined References (6)

PMID Year Title
23533661 2013 ZBED evolution: repeated utilization of DNA transposons as regulators of diverse host functions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.