Property Summary

NCBI Gene PubMed Count 29
PubMed Score 48.95
PubTator Score 15.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Breast cancer -2.300 1.0e-14
breast carcinoma -1.200 1.9e-20
Chronic Lymphocytic Leukemia 1.264 6.1e-03
chronic rhinosinusitis -1.659 9.2e-03
glioblastoma 1.300 1.5e-02
interstitial lung disease -1.300 2.4e-02
intraductal papillary-mucinous neoplasm ... 1.400 3.7e-02
lung cancer -1.500 4.1e-04
mucosa-associated lymphoid tissue lympho... 1.397 1.0e-02
ovarian cancer -1.200 9.9e-04
pancreatic cancer 1.100 2.8e-05
pituitary cancer -2.100 3.7e-07
primary pancreatic ductal adenocarcinoma 1.793 9.7e-03
psoriasis 1.800 7.2e-05
Rheumatoid arthritis 1.100 1.1e-02
spina bifida -1.638 4.8e-02

Protein-protein Interaction (2)

Gene RIF (15)

AA Sequence

MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAIS      1 - 70
NKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACR     71 - 140
IICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREIS    141 - 210
VCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARP    211 - 280
QCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCE    281 - 350
AGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD      351 - 418
//

Text Mined References (30)

PMID Year Title