Property Summary

NCBI Gene PubMed Count 23
Grant Count 17
R01 Count 17
Funding $3,173,987.88
PubMed Score 45.62
PubTator Score 15.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.011
interstitial lung disease -1.300 0.024
Chronic Lymphocytic Leukemia 1.264 0.006
psoriasis 1.800 0.000
glioblastoma 1.300 0.015
primary pancreatic ductal adenocarcinoma 1.793 0.010
intraductal papillary-mucinous neoplasm ... 1.400 0.037
lung cancer -1.500 0.000
pancreatic cancer 1.200 0.031
breast carcinoma -1.200 0.000
spina bifida -1.638 0.048
Breast cancer -2.300 0.000
mucosa-associated lymphoid tissue lympho... 1.397 0.010
ovarian cancer 2.300 0.000
pituitary cancer -2.100 0.000
chronic rhinosinusitis -1.659 0.009

Gene RIF (10)

PMID Text
25712248 The study results in the Chinese Han population showed that PELI1 is a member of a constellation of genetic factors that may contribute to the pathogenesis of systemic lupus erythematosus.
25295537 Increased PELI1 expression and subsequent induction of BCL6 promotes lymphomagenesis.
25027698 Peptide PEL1 derived from the interleukin-1 receptor-associated kinase (IRAK)1-binding motif reveals a distinct phosphothreonine peptide binding preference.
23921680 GWAS study found two new SNPs associated with nickel dermatitis; SNPs are located in the NTN4 and PELI1 genes
23846693 Pellino1 interacts with the transcription factor Deformed Epidermal Autoregulatory Factor 1 (DEAF1).
22105492 incomplete KD, IVIG nonresponsiveness, long febrile days, and the rs7604693 genetic variant in the PELI1 gene are major risk factors for the development of CALs
18976975 Knockdown of pellino E3 ubiquitin protein ligase 1 (PELI1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17675297 kinase-inactive IRAK proteins can associate with Pellino proteins, thus excluding the possibility that their inability to regulate Pellino degradation is due to lack of association with the Pellino proteins
16951688 Smad6 bound to Pellino-1 promoted TGF-beta-mediated anti-inflammatory effects.
12496252 role in interleukin-1-mediated signalling through interaction with interleukin-1 receptor-associated kinase 4-IRAK-tumor necrosis factor receptor-associated factor 6 complex

AA Sequence

MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAIS      1 - 70
NKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACR     71 - 140
IICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREIS    141 - 210
VCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARP    211 - 280
QCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCE    281 - 350
AGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD      351 - 418
//

Text Mined References (24)

PMID Year Title
25712248 2015 Association of PELI1 polymorphisms in systemic lupus erythematosus susceptibility in a Chinese population.
25416956 2014 A proteome-scale map of the human interactome network.
25295537 2014 Pellino 1 promotes lymphomagenesis by deregulating BCL6 polyubiquitination.
25027698 2014 The pellino e3 ubiquitin ligases recognize specific phosphothreonine motifs and have distinct substrate specificities.
23921680 2013 A genome-wide association study in Koreans identifies susceptibility loci for allergic nickel dermatitis.
23846693 2013 DEAF1 is a Pellino1-interacting protein required for interferon production by Sendai virus and double-stranded RNA.
22105492 2012 Assessment of risk factors for Korean children with Kawasaki disease.
21221998 2011 A genome-wide association analysis reveals 1p31 and 2p13.3 as susceptibility loci for Kawasaki disease.
21120624 2011 Pellino-1, an adaptor protein of interleukin-1 receptor/toll-like receptor signaling, is sumoylated by Ubc9.
17997719 2008 The IRAK-catalysed activation of the E3 ligase function of Pellino isoforms induces the Lys63-linked polyubiquitination of IRAK1.
More...