Property Summary

NCBI Gene PubMed Count 31
PubMed Score 28.06
PubTator Score 8.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
MENTAL RETARDATION, AUTOSOMAL RECESSIVE 50 1 0.0 0.0
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Disease Target Count Z-score Confidence
Melioidosis 17 4.125 2.1
Syringomyelia 15 3.687 1.8
gliosarcoma 18 3.012 1.5

Expression

Synonym

Accession Q96F86 B3KPH0 D3DW61 Q9H797
Symbols YJDC
LSM16
MRT50
YJEFN2
hYjeF_N2-15q23

Gene

PDB

2WAX   2WAY   2VC8   3D3J   3D3K  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (4)

AA Sequence

MATDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGP      1 - 70
GDNQHFGDLHQTELGPSGAGCQVGINQNGTGKFVKKPASSSSAPQNIPKRTDVKSQDVAVSPQQQQCSKS     71 - 140
YVDRHMESLSQSKSFRRRHNSWSSSSRHPNQATPKKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNL    141 - 210
ALFDKAAVFEEIDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVP    211 - 280
SISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQG    281 - 350
ISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLR    351 - 420
DQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVG    421 - 490
INYHSPFGCKFVIPLHSA                                                        491 - 508
//

Text Mined References (40)

PMID Year Title