Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.65
PubTator Score 1.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 2.04143096648444E-22
ovarian cancer 8492 5.86254320226956E-15
lung adenocarcinoma 2714 5.1430480071067E-8
Duchenne muscular dystrophy 602 1.73238223615322E-7
posterior fossa group B ependymoma 1530 2.21574819650326E-7
atypical teratoid / rhabdoid tumor 4369 1.4463739727079E-6
pituitary cancer 1972 3.34946151518464E-6
ulcerative colitis 2087 3.4595716210428E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 8.00082254201219E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.31384223100502E-4
Pick disease 1893 2.74649498953722E-4
medulloblastoma, large-cell 6234 3.1623797374779E-4
invasive ductal carcinoma 2950 4.38662758958859E-4
pediatric high grade glioma 2712 4.40475512707688E-4
medulloblastoma 1524 6.94611044646823E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 7.84465964378667E-4
glioblastoma 5572 9.98556797500761E-4
Atopic dermatitis 944 0.00123145863909381
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00186117105137183
primary pancreatic ductal adenocarcinoma 1271 0.0032523745784316
pancreatic cancer 2300 0.00357157875268969
ductal carcinoma in situ 1745 0.00604564444698679
subependymal giant cell astrocytoma 2287 0.0145959562532079

Expression

Synonym

Accession Q96F85 B2R4D0 Q49AN4 Q9UFZ0 CRIP-1
Symbols CRIP1
C2orf32

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular cannabinoid receptor interacting protein 1 (CNRIP1) is identified by yeast two-hybrid screen
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVP      1 - 70
LELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPF     71 - 140
SVIEYECKPNETRSLMWVNKESFL                                                  141 - 164
//

Text Mined References (11)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20590557 2010 Cannabinoid CB1 receptor-interacting proteins: novel targets for central nervous system drug discovery?
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17895407 2007 CB1 cannabinoid receptor activity is modulated by the cannabinoid receptor interacting protein CRIP 1a.
16696853 2006 A yeast 2-hybrid analysis of human GTP cyclohydrolase I protein interactions.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...