Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.53
PubTator Score 1.51

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96F85 B2R4D0 Q49AN4 Q9UFZ0 CRIP-1
Symbols CRIP1
C2orf32

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVP      1 - 70
LELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPF     71 - 140
SVIEYECKPNETRSLMWVNKESFL                                                  141 - 164
//

Text Mined References (12)

PMID Year Title