Property Summary

NCBI Gene PubMed Count 9
Grant Count 9
Funding $299,549.33
PubMed Score 8.65
PubTator Score 1.51

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular cannabinoid receptor interacting protein 1 (CNRIP1) is identified by yeast two-hybrid screen
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVP      1 - 70
LELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPF     71 - 140
SVIEYECKPNETRSLMWVNKESFL                                                  141 - 164
//

Text Mined References (11)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20590557 2010 Cannabinoid CB1 receptor-interacting proteins: novel targets for central nervous system drug discovery?
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17895407 2007 CB1 cannabinoid receptor activity is modulated by the cannabinoid receptor interacting protein CRIP 1a.
16696853 2006 A yeast 2-hybrid analysis of human GTP cyclohydrolase I protein interactions.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...