Property Summary

NCBI Gene PubMed Count 68
PubMed Score 107.64
PubTator Score 90.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Plaque psoriasis 14
Disease Target Count P-value
lung carcinoma 2844 6.78303821813919E-25
pilocytic astrocytoma 3086 1.49687429629923E-8
ovarian cancer 8492 5.5610783134619E-6
hepatocellular carcinoma 550 3.01866393290546E-5
pediatric high grade glioma 2712 3.98710404942524E-5
osteosarcoma 7933 4.94816928814222E-5
glioblastoma 5572 1.60174090019156E-4
pituitary cancer 1972 3.75718991195108E-4
tuberculosis 1563 4.98270925161207E-4
group 3 medulloblastoma 2254 0.00230747815765162
astrocytoma 1493 0.00377737284879297
pancreatic carcinoma 567 0.00545176641405382
pancreatic cancer 2300 0.00545176641405389

Expression

  Differential Expression (13)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.000
pancreatic cancer 1.200 0.005
osteosarcoma -3.230 0.000
astrocytoma 1.300 0.004
glioblastoma 1.300 0.000
tuberculosis 1.500 0.000
pediatric high grade glioma 1.100 0.000
group 3 medulloblastoma -1.400 0.002
pilocytic astrocytoma 1.300 0.000
pancreatic carcinoma 1.200 0.005
lung carcinoma -1.500 0.000
ovarian cancer 1.400 0.000
pituitary cancer -1.300 0.000

Synonym

Accession Q96F46 O43844 Q20WK1 IL-17 receptor A
Symbols CD217
IL17R
CANDF5
CDw217
IL-17RA
hIL-17R

Gene

PDB

3JVF   4HSA   4NUX  

  Ortholog (11)

Gene RIF (54)

PMID Text
26667835 IL17F and IL17RA polymorphisms modulate susceptibility to cerebral malaria(CM) and provide evidence that IL-17F protects against CM.
26607704 IL-17 receptor A and adenosine deaminase 2 deficiency due to deletion mutations was found in siblings with chronic mucocutaneous candidiasis and chronic systemic inflammation.
26451724 The data indicate that the genetic variants of rs2275913 in IL-17A, rs763780 in IL-17F, and rs4819554 in IL-17RA may not play a role in the pathogenesis of preeclampsia in Chinese Han women.
26356122 expression of immunoreactivity for IL-17A, IL-17RA, IL-17E, and IL-17F was significantly elevated in prostatic tissue from benign prostatic hyperplasia and prostate cancer compared with that in controls
26347322 Identified the IL17RA rs4819554 SNP as a risk factor for psoriasis.
26261590 Increased expression of IL-17RA plays an important role in gastric cancer progression, migration and prognosis.
26228109 High IL-17RA expression is associated with Intrahepatic Cholangiocarcinoma.
26198032 In vitro, CSE stimulation significantly increased IL-17F and IL-17R in 16HBE (2.5%) and A549 (5%) while IL-17A and IL-17F in PBMC (10%). IL-17A and CSE stimulation, rather than CSE or rhIL-17A alone, increased proliferation in 16HBE and apoptosis in A549
26123260 The presence of IL7R polymorphisms seems to be related to severe liver disease in HIV/hepatitis c virus coinfected patients.
25935436 Both genetic variants of IL-17R (rs882643 and rs2241049) were associated with PGD. This confirms a genetic predisposition toward PGD and suggests a role of IL-17 in driving neutrophilia in PGD.
More...

AA Sequence

MGAARSPPSAVPGPLLGLLLLLLGVLAPGGASLRLLDHRALVCSQPGLNCTVKNSTCLDDSWIHPRNLTP      1 - 70
SSPKDLQIQLHFAHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLNTNERLCVRFEFLSKLRHHHR     71 - 140
RWRFTFSHFVVDPDQEYEVTVHHLPKPIPDGDPNHQSKNFLVPDCEHARMKVTTPCMSSGSLWDPNITVE    141 - 210
TLEAHQLRVSFTLWNESTHYQILLTSFPHMENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQ    211 - 280
VQIQPFFSSCLNDCLRHSATVSCPEMPDTPEPIPDYMPLWVYWFITGISILLVGSVILLIVCMTWRLAGP    281 - 350
GSEKYSDDTKYTDGLPAADLIPPPLKPRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQAI    351 - 420
SEAGVMTWVGRQKQEMVESNSKIIVLCSRGTRAKWQALLGRGAPVRLRCDHGKPVGDLFTAAMNMILPDF    421 - 490
KRPACFGTYVVCYFSEVSCDGDVPDLFGAAPRYPLMDRFEEVYFRIQDLEMFQPGRMHRVGELSGDNYLR    491 - 560
SPGGRQLRAALDRFRDWQVRCPDWFECENLYSADDQDAPSLDEEVFEEPLLPPGTGIVKRAPLVREPGSQ    561 - 630
ACLAIDPLVGEEGGAAVAKLEPHLQPRGQPAPQPLHTLVLAAEEGALVAAVEPGPLADGAAVRLALAGEG    631 - 700
EACPLLGSPGAGRNSVLFLPVDPEDSPLGSSTPMASPDLLPEDVREHLEGLMLSLFEQSLSCQAQGGCSR    701 - 770
PAMVLTDPHTPYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQ    771 - 840
RQLLFRQLQKNSGWDTMGSESEGPSA                                                841 - 866
//

Text Mined References (71)

PMID Year Title
26667835 2015 The IL17F and IL17RA Genetic Variants Increase Risk of Cerebral Malaria in Two African Populations.
26607704 2016 IL-17 receptor A and adenosine deaminase 2 deficiency in siblings with recurrent infections and chronic inflammation.
26451724 2015 Role of IL-17 Variants in Preeclampsia in Chinese Han Women.
26356122 2015 Expression of IL-17A, E, and F and their receptors in human prostatic cancer: Comparison with benign prostatic hyperplasia.
26347322 2015 Association between single nucleotide polymorphisms IL17RA rs4819554 and IL17E rs79877597 and Psoriasis in a Spanish cohort.
26261590 2015 Increased chemokine receptor IL-17RA expression is associated with poor survival in gastric cancer patients.
26228109 2015 Prognostic Impact of Peritumoral IL-17-Positive Cells and IL-17 Axis in Patients with Intrahepatic Cholangiocarcinoma.
26198032 2015 Cigarette smoke affects IL-17A, IL-17F and IL-17 receptor expression in the lung tissue: Ex vivo and in vitro studies.
26123260 2015 Association between IL7R polymorphisms and severe liver disease in HIV/HCV coinfected patients: a cross-sectional study.
25935436 2015 Interleukin-17 receptor polymorphism predisposes to primary graft dysfunction after lung transplantation.
More...