Property Summary

Ligand Count 1
NCBI Gene PubMed Count 75
PubMed Score 122.69
PubTator Score 90.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.300 3.8e-03
Astrocytoma, Pilocytic 1.400 1.6e-08
glioblastoma 1.300 1.6e-04
group 3 medulloblastoma -1.200 6.4e-03
hepatocellular carcinoma 1.200 3.0e-05
lung carcinoma -1.500 6.8e-25
osteosarcoma -1.782 4.1e-04
ovarian cancer 1.400 5.6e-06
pancreatic cancer 1.200 5.5e-03
pancreatic carcinoma 1.200 5.5e-03
pediatric high grade glioma 1.100 4.0e-05
pituitary cancer -1.200 1.9e-03
tuberculosis 1.500 5.0e-04

Gene RIF (61)

AA Sequence

MGAARSPPSAVPGPLLGLLLLLLGVLAPGGASLRLLDHRALVCSQPGLNCTVKNSTCLDDSWIHPRNLTP      1 - 70
SSPKDLQIQLHFAHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLNTNERLCVRFEFLSKLRHHHR     71 - 140
RWRFTFSHFVVDPDQEYEVTVHHLPKPIPDGDPNHQSKNFLVPDCEHARMKVTTPCMSSGSLWDPNITVE    141 - 210
TLEAHQLRVSFTLWNESTHYQILLTSFPHMENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQ    211 - 280
VQIQPFFSSCLNDCLRHSATVSCPEMPDTPEPIPDYMPLWVYWFITGISILLVGSVILLIVCMTWRLAGP    281 - 350
GSEKYSDDTKYTDGLPAADLIPPPLKPRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQAI    351 - 420
SEAGVMTWVGRQKQEMVESNSKIIVLCSRGTRAKWQALLGRGAPVRLRCDHGKPVGDLFTAAMNMILPDF    421 - 490
KRPACFGTYVVCYFSEVSCDGDVPDLFGAAPRYPLMDRFEEVYFRIQDLEMFQPGRMHRVGELSGDNYLR    491 - 560
SPGGRQLRAALDRFRDWQVRCPDWFECENLYSADDQDAPSLDEEVFEEPLLPPGTGIVKRAPLVREPGSQ    561 - 630
ACLAIDPLVGEEGGAAVAKLEPHLQPRGQPAPQPLHTLVLAAEEGALVAAVEPGPLADGAAVRLALAGEG    631 - 700
EACPLLGSPGAGRNSVLFLPVDPEDSPLGSSTPMASPDLLPEDVREHLEGLMLSLFEQSLSCQAQGGCSR    701 - 770
PAMVLTDPHTPYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQ    771 - 840
RQLLFRQLQKNSGWDTMGSESEGPSA                                                841 - 866
//

Text Mined References (78)

PMID Year Title