Property Summary

NCBI Gene PubMed Count 68
Grant Count 118
R01 Count 80
Funding $7,219,001.22
PubMed Score 107.64
PubTator Score 90.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.000
pancreatic cancer 1.200 0.005
osteosarcoma -3.230 0.000
astrocytoma 1.300 0.004
glioblastoma 1.300 0.000
tuberculosis 1.500 0.000
pediatric high grade glioma 1.100 0.000
group 3 medulloblastoma -1.400 0.002
pilocytic astrocytoma 1.300 0.000
pancreatic carcinoma 1.200 0.005
lung carcinoma -1.500 0.000
ovarian cancer 1.400 0.000
pituitary cancer -1.300 0.000

Synonym

Accession Q96F46 O43844 Q20WK1 IL-17 receptor A
Symbols CD217
IL17R
CANDF5
CDw217
IL-17RA
hIL-17R

Gene

PDB

3JVF   4HSA   4NUX  

Gene RIF (54)

PMID Text
26667835 IL17F and IL17RA polymorphisms modulate susceptibility to cerebral malaria(CM) and provide evidence that IL-17F protects against CM.
26607704 IL-17 receptor A and adenosine deaminase 2 deficiency due to deletion mutations was found in siblings with chronic mucocutaneous candidiasis and chronic systemic inflammation.
26451724 The data indicate that the genetic variants of rs2275913 in IL-17A, rs763780 in IL-17F, and rs4819554 in IL-17RA may not play a role in the pathogenesis of preeclampsia in Chinese Han women.
26356122 expression of immunoreactivity for IL-17A, IL-17RA, IL-17E, and IL-17F was significantly elevated in prostatic tissue from benign prostatic hyperplasia and prostate cancer compared with that in controls
26347322 Identified the IL17RA rs4819554 SNP as a risk factor for psoriasis.
26261590 Increased expression of IL-17RA plays an important role in gastric cancer progression, migration and prognosis.
26228109 High IL-17RA expression is associated with Intrahepatic Cholangiocarcinoma.
26198032 In vitro, CSE stimulation significantly increased IL-17F and IL-17R in 16HBE (2.5%) and A549 (5%) while IL-17A and IL-17F in PBMC (10%). IL-17A and CSE stimulation, rather than CSE or rhIL-17A alone, increased proliferation in 16HBE and apoptosis in A549
26123260 The presence of IL7R polymorphisms seems to be related to severe liver disease in HIV/hepatitis c virus coinfected patients.
25935436 Both genetic variants of IL-17R (rs882643 and rs2241049) were associated with PGD. This confirms a genetic predisposition toward PGD and suggests a role of IL-17 in driving neutrophilia in PGD.
More...

AA Sequence

MGAARSPPSAVPGPLLGLLLLLLGVLAPGGASLRLLDHRALVCSQPGLNCTVKNSTCLDDSWIHPRNLTP      1 - 70
SSPKDLQIQLHFAHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLNTNERLCVRFEFLSKLRHHHR     71 - 140
RWRFTFSHFVVDPDQEYEVTVHHLPKPIPDGDPNHQSKNFLVPDCEHARMKVTTPCMSSGSLWDPNITVE    141 - 210
TLEAHQLRVSFTLWNESTHYQILLTSFPHMENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQ    211 - 280
VQIQPFFSSCLNDCLRHSATVSCPEMPDTPEPIPDYMPLWVYWFITGISILLVGSVILLIVCMTWRLAGP    281 - 350
GSEKYSDDTKYTDGLPAADLIPPPLKPRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQAI    351 - 420
SEAGVMTWVGRQKQEMVESNSKIIVLCSRGTRAKWQALLGRGAPVRLRCDHGKPVGDLFTAAMNMILPDF    421 - 490
KRPACFGTYVVCYFSEVSCDGDVPDLFGAAPRYPLMDRFEEVYFRIQDLEMFQPGRMHRVGELSGDNYLR    491 - 560
SPGGRQLRAALDRFRDWQVRCPDWFECENLYSADDQDAPSLDEEVFEEPLLPPGTGIVKRAPLVREPGSQ    561 - 630
ACLAIDPLVGEEGGAAVAKLEPHLQPRGQPAPQPLHTLVLAAEEGALVAAVEPGPLADGAAVRLALAGEG    631 - 700
EACPLLGSPGAGRNSVLFLPVDPEDSPLGSSTPMASPDLLPEDVREHLEGLMLSLFEQSLSCQAQGGCSR    701 - 770
PAMVLTDPHTPYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQ    771 - 840
RQLLFRQLQKNSGWDTMGSESEGPSA                                                841 - 866
//

Text Mined References (71)

PMID Year Title
26667835 2015 The IL17F and IL17RA Genetic Variants Increase Risk of Cerebral Malaria in Two African Populations.
26607704 2016 IL-17 receptor A and adenosine deaminase 2 deficiency in siblings with recurrent infections and chronic inflammation.
26451724 2015 Role of IL-17 Variants in Preeclampsia in Chinese Han Women.
26356122 2015 Expression of IL-17A, E, and F and their receptors in human prostatic cancer: Comparison with benign prostatic hyperplasia.
26347322 2015 Association between single nucleotide polymorphisms IL17RA rs4819554 and IL17E rs79877597 and Psoriasis in a Spanish cohort.
26261590 2015 Increased chemokine receptor IL-17RA expression is associated with poor survival in gastric cancer patients.
26228109 2015 Prognostic Impact of Peritumoral IL-17-Positive Cells and IL-17 Axis in Patients with Intrahepatic Cholangiocarcinoma.
26198032 2015 Cigarette smoke affects IL-17A, IL-17F and IL-17 receptor expression in the lung tissue: Ex vivo and in vitro studies.
26123260 2015 Association between IL7R polymorphisms and severe liver disease in HIV/HCV coinfected patients: a cross-sectional study.
25935436 2015 Interleukin-17 receptor polymorphism predisposes to primary graft dysfunction after lung transplantation.
More...