Property Summary

NCBI Gene PubMed Count 22
PubMed Score 34.45
PubTator Score 13.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
inflammatory breast cancer 1.100 2.4e-02
intraductal papillary-mucinous carcinoma... 1.100 1.2e-03
osteosarcoma -1.165 2.8e-03
Rheumatoid arthritis 1.300 1.3e-02
tuberculosis and treatment for 6 months 1.100 4.8e-05

Gene RIF (15)

AA Sequence

MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELSPQRNLRPNRP      1 - 70
LAKMAEMARRLHPPSPVPQGVCPAHREPLAAFCGDELRLLCAACERSGEHWAHRVRPLQDAAEDLKAKLE     71 - 140
KSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLGEFERLRRLLAEEEQQLLQRLEEEELEVLPR    141 - 210
LREGAAHLGQQSAHLAELIAELEGRCQLPALGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVE    211 - 280
TLRRFRGDVTLDPDTANPELILSEDRRSVQRGDLRQALPDSPERFDPGPCVLGQERFTSGRHYWEVEVGD    281 - 350
RTSWALGVCRENVNRKEKGELSAGNGFWILVFLGSYYNSSERALAPLRDPPRRVGIFLDYEAGHLSFYSA    351 - 420
TDGSLLFIFPEIPFSGTLRPLFSPLSSSPTPMTICRPKGGSGDTLAPQ                          421 - 468
//

Text Mined References (24)

PMID Year Title