Property Summary

NCBI Gene PubMed Count 16
PubMed Score 31.88
PubTator Score 13.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Synonym

Accession Q96F44 A6NKE2 B2RB82 B3KUS3 B4DX88 Q5VSU1 Q8NCA6 Q9C022
Symbols BIA1
RNF92

Gene

PANTHER Protein Class (2)

Gene RIF (11)

PMID Text
25105968 TRIM11 is a host cellular factor that interferes with the early steps of HIV-1 replication and provides a connection between viral protein and host antiviral factors.
25105968 HIV-1 Vpr may indirectly regulate TRIM11 in a dose-dependent manner, which is independent of the ubiquitin system or VprBP-mediated pathway
23675467 TRIM11 negatively regulates IFN-beta production and antiviral activity by targeting TBK1.
23178488 TRIM11 is overexpressed in high-grade gliomas and promotes proliferation, invasion, migration and glial tumor growth.
22307522 Study shows that the E3 ubiquitin ligase TRIM11 plays a critical role in the clearance of mutant PHOX2B, which causes congenital central hypoventilation syndrome, through the proteasome.
19472918 Observational study of gene-disease association. (HuGE Navigator)
18275850 This study suggests a potential role for Trim11 in the specification of NA phenotype by interaction with Phox2b.
18248090 Downregulation of TRIM11 and TRIM15 enhanced virus release suggesting that these proteins contribute to the endogenous restriction of retroviruses in cells.
18248090 HIV-1 Vpr may indirectly regulate TRIM11 in a dose-dependent manner, which is independent of the ubiquitin system or VprBP-mediated pathway
16904669 These results suggest that TRIM11, with the ubiquitin-proteasome pathway, regulates ARC105 function in TGFbeta signaling.
More...

AA Sequence

MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELSPQRNLRPNRP      1 - 70
LAKMAEMARRLHPPSPVPQGVCPAHREPLAAFCGDELRLLCAACERSGEHWAHRVRPLQDAAEDLKAKLE     71 - 140
KSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLGEFERLRRLLAEEEQQLLQRLEEEELEVLPR    141 - 210
LREGAAHLGQQSAHLAELIAELEGRCQLPALGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVE    211 - 280
TLRRFRGDVTLDPDTANPELILSEDRRSVQRGDLRQALPDSPERFDPGPCVLGQERFTSGRHYWEVEVGD    281 - 350
RTSWALGVCRENVNRKEKGELSAGNGFWILVFLGSYYNSSERALAPLRDPPRRVGIFLDYEAGHLSFYSA    351 - 420
TDGSLLFIFPEIPFSGTLRPLFSPLSSSPTPMTICRPKGGSGDTLAPQ                          421 - 468
//

Text Mined References (18)

PMID Year Title
25271088 2015 Gene by stress genome-wide interaction analysis and path analysis identify EBF1 as a cardiovascular and metabolic risk gene.
25105968 2014 The human antiviral factor TRIM11 is under the regulation of HIV-1 Vpr.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23675467 2013 TRIM11 negatively regulates IFN? production and antiviral activity by targeting TBK1.
23178488 2013 TRIM11 is overexpressed in high-grade gliomas and promotes proliferation, invasion, migration and glial tumor growth.
22307522 2012 The E3 ubiquitin ligase TRIM11 mediates the degradation of congenital central hypoventilation syndrome-associated polyalanine-expanded PHOX2B.
19472918 2008 Candidate-gene testing for orphan limb-girdle muscular dystrophies.
18275850 2008 Trim11 increases expression of dopamine beta-hydroxylase gene by interacting with Phox2b.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...