Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.59
PubTator Score 1.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.600 3.4e-02
group 3 medulloblastoma 1.100 1.8e-02
ovarian cancer 1.700 6.3e-05
pancreatic cancer 1.400 1.1e-02
pancreatic carcinoma 1.400 1.1e-02
posterior fossa group A ependymoma 1.200 1.6e-05

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MVCVLVLAAAAGAVAVFLILRIWVVLRSMDVTPRESLSILVVAGSGGHTTEILRLLGSLSNAYSPRHYVI      1 - 70
ADTDEMSANKINSFELDRADRDPSNMYTKYYIHRIPRSREVQQSWPSTVFTTLHSMWLSFPLIHRVKPDL     71 - 140
VLCNGPGTCVPICVSALLLGILGIKKVIIVYVESICRVETLSMSGKILFHLSDYFIVQWPALKEKYPKSV    141 - 210
YLGRIV                                                                    211 - 216
//

Text Mined References (10)

PMID Year Title