Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.59
PubTator Score 1.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.400 0.011
group 3 medulloblastoma 1.100 0.018
posterior fossa group B ependymoma 1.300 0.000
pancreatic carcinoma 1.400 0.011
acute myeloid leukemia -1.600 0.034
ovarian cancer 1.700 0.000

Synonym

Accession Q96F25 A8K030
Symbols CMS15

Gene

Gene RIF (3)

PMID Text
23404334 We identify ALG14 and ALG2 as novel genes in which mutations cause a congenital myasthenic syndrome
18976975 Knockdown of asparagine-linked glycosylation 14 homolog (ALG14) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
16100110 ALG13 and ALG14 form a functional endoplasmic reticulum UDP-N-acetylglucosamine transferase

AA Sequence

MVCVLVLAAAAGAVAVFLILRIWVVLRSMDVTPRESLSILVVAGSGGHTTEILRLLGSLSNAYSPRHYVI      1 - 70
ADTDEMSANKINSFELDRADRDPSNMYTKYYIHRIPRSREVQQSWPSTVFTTLHSMWLSFPLIHRVKPDL     71 - 140
VLCNGPGTCVPICVSALLLGILGIKKVIIVYVESICRVETLSMSGKILFHLSDYFIVQWPALKEKYPKSV    141 - 210
YLGRIV                                                                    211 - 216
//

Text Mined References (9)

PMID Year Title
23404334 2013 Congenital myasthenic syndromes due to mutations in ALG2 and ALG14.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
17686769 2007 Membrane topology of the Alg14 endoplasmic reticulum UDP-GlcNAc transferase subunit.
16100110 2005 Alg14 recruits Alg13 to the cytoplasmic face of the endoplasmic reticulum to form a novel bipartite UDP-N-acetylglucosamine transferase required for the second step of N-linked glycosylation.
15615718 2005 Two proteins homologous to the N- and C-terminal domains of the bacterial glycosyltransferase Murg are required for the second step of dolichyl-linked oligosaccharide synthesis in Saccharomyces cerevisiae.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.